Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain |
| Positive IHC detected in | human brain tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF-Fro detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10274-1-AP targets TAU in WB, IHC, IF-P, IF-Fro, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0354 Product name: Recombinant human TAU protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 5-208 aa of BC000558 Sequence: PRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENL Predict reactive species |
| Full Name | microtubule-associated protein tau |
| Calculated Molecular Weight | 37-46, 79-81 kDa |
| Observed Molecular Weight | 45-70 kDa, 100 kDa |
| GenBank Accession Number | BC000558 |
| Gene Symbol | TAU |
| Gene ID (NCBI) | 4137 |
| RRID | AB_2139718 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P10636 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Tau (tubulin-associated unit) is a microtubule-associated protein (also known as MAPT), expressed mainly in neurons of the central nervous system. Its primary function is to modulate microtubule dynamics for maintaining axonal cytoskeleton. Various isoforms of Tau exist due to the alternative splicing, and short isoforms around 45-69 kDa and long isoforms around 100-110 kDa have been reported in different literature (8752131,15965697). Present polyclonal anti-Tau antibody was produced by immunizing animals with N-terminal of Tau and can detect approx 45-70 kDa and 100-kDa bands in brain tissues.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TAU antibody 10274-1-AP | Download protocol |
| IHC protocol for TAU antibody 10274-1-AP | Download protocol |
| WB protocol for TAU antibody 10274-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TAU Polyclonal antibody (catalog #10274-1-AP) has 84 citations. It appears in journals including Cell Research, Autophagy, Neuron, Redox Biology, Acta Pharm Sin B, J Clin Invest, Science Advances, Brain, Cell Death Discovery, Journal of Translational Medicine, Genome Biology, Alzheimer's Research & Therapy, Neural Regeneration Research, Free Radical Biology & Medicine, Cell & Molecular Neurobiology, Analytical Chemistry, Neuroscience Bulletin, Ecotoxicology & Environmental Safety, Science of the Total Environment, Acta Neuropathologica Communications, Molecular Therapy Nucleic Acids, Foods, Nutrients, Communications Biology, Pharmaceuticals, Biomolecules, International Journal of Molecular Sciences, International Immunopharmacology, Molecular Neurobiology, Frontiers in Pharmacology, Frontiers in Aging Neuroscience, Bioorganic Chemistry, Current Research in Toxicology, Journal of Neurochemistry, Biomedical Pharmacotherapy, ACS Chemical Neuroscience, Neurochemistry Research, Biological Trace Element Research, FASEB Journal, FEBS Journal, BMC Cancer, Frontiers in Neuroscience, Journal of Cellular Physiology, Cell Cycle, Journal of Cell Science, Neurotoxicology, Metabolic Brain Disease, Molecular Brain, Cell Biology International, Neural Plasticity, Archives of Microbiology, Neuroscience, Animal Model and Experimental Medicine, Brain Research, Molecular Biology Reports, Neuroscientific Research, Human Molecular Genetics, Toxicology in Vitro, Acta Tropica, Journal of Toxicology and Environmental Health, Journal of Comparative Neurology, Bioengineered, Inhalation Toxicology, American Journal of Translational Research, Biological & Pharmaceutical Bulletin, Experimental & Clinical Endocrinology & Diabetes, Ageing Neurodegenerative Diseases, and Journal of Fungi. Research fields span Alzheimer's disease, neurodegeneration, tau phosphorylation, neuroprotection, cognitive impairment, Parkinson's disease, and related signaling pathways.
| Species | Application | Title |
|---|---|---|
Cell Res Tau is a receptor with low affinity for glucocorticoids and is required for glucocorticoid-induced bone loss | ||
Autophagy The ER protein CANX (calnexin)-mediated autophagy protects against alzheimer disease | ||
Neuron Hepatic expression of APOE3 Christchurch mitigates APOE4-related Alzheimer's disease pathologies in mice. | ||
Redox Biol Absence of astrocytic ceruloplasmin reverses the senescence process with aging of learning and memory abilities | ||
Acta Pharm Sin B Pleiotropic prodrugs for both symptomatic and disease-modifying treatment of Alzheimer's disease. | ||
J Clin Invest TP53/TAU axis regulates microtubule bundling to control alveolar stem cell-mediated regeneration.
|
Reviews
What customers say
Customers report consistent performance across applications. For Western blot, the antibody produced a single band at approximately 45 kDa, matching the datasheet, when used at 1:1000 dilution in neuronal stem cells and SH-SY5Y lysate. For immunofluorescence at 1:100, it worked well with mouse primary cells and brain tissue. Overall ratings average 4.3 out of 5, with users noting reliable specificity and expected molecular weight. No significant issues were mentioned in the available reviews.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
manohar (Verified Customer) (03-06-2024) |
|
David (Verified Customer) (01-02-2024) | Produces a single band at around 45kDa which is concordant with the data sheet.
|
Tanusree (Verified Customer) (02-14-2019) | The antibody worked well with the mouse primary cells and tissue.
|
