Tested Applications
| Positive WB detected in | A549 cells, HuH-7 cells, HeLa cells, rat brain tissue, mouse brain tissue, Calu-1 cells |
| Positive IP detected in | A2780 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14994-1-AP targets METTL1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6980 Product name: Recombinant human METTL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-276 aa of BC000550 Sequence: MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH Predict reactive species |
| Full Name | methyltransferase like 1 |
| Calculated Molecular Weight | 31 kDa |
| Observed Molecular Weight | 31 kDa |
| GenBank Accession Number | BC000550 |
| Gene Symbol | METTL1 |
| Gene ID (NCBI) | 4234 |
| RRID | AB_2142013 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UBP6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
METTL1 methyltransferase mediates m7G methylation within miRNAs and regulates cell migration via its catalytic activity. METTL1 can be inactivated by phosphorylation at Ser27 by protein kinase B (PKBα). Overexpression of METTL1 is widely observed among human cancers. It is also crucial for the regulation of chemoresistance in cancer treatment. In addition, mutations in the human N7-methylguanosine (m7G) methyltransferase complex METTL1/WDR4 cause primordial dwarfism and brain malformation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for METTL1 antibody 14994-1-AP | Download protocol |
| IHC protocol for METTL1 antibody 14994-1-AP | Download protocol |
| IP protocol for METTL1 antibody 14994-1-AP | Download protocol |
| WB protocol for METTL1 antibody 14994-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The METTL1 Polyclonal antibody (catalog number 14994-1-AP) has 51 citations. Citations appear in journals including Nature, Cell, Molecular Cell, Nature Communications, Blood, Oncogene, Molecular Therapy, Nucleic Acids Research, Journal of Clinical Investigation, Cell Reports, Frontiers in Immunology, Cancer Communications, Experimental Hematology & Oncology, and several other oncology, molecular biology, and translational medicine journals. Research fields include RNA/tRNA m7G modification, epitranscriptomics, cancer biology, translation regulation, tumor progression, drug resistance, neurodegeneration, metabolism, and immune regulation.
| Species | Application | Title |
|---|---|---|
Cell QKI shuttles internal m7G-modified transcripts into stress granules and modulates mRNA metabolism
| ||
Cell Res Dynamic methylome of internal mRNA N7-methylguanosine and its regulatory role in translation. | ||
Adv Mater Dual Targeting of m(7)G tRNA Modification and Histone Acetylation using Carrier-Free Nano-Epidrugs to Evoke Osteosarcoma Chemosensitization.
| ||
Cancer Commun (Lond) Aberrant translation regulated by METTL1/WDR4-mediated tRNA N7-methylguanosine modification drives head and neck squamous cell carcinoma progression.
|
Reviews
What customers say
Both reviewers used this antibody for Western Blot at a 1:1000 dilution. One reported a clear band in HEK293T cells, while the other observed a single specific band at the expected molecular weight in human fibroblasts after overnight primary incubation. Overall, users found the antibody to produce clean, specific results with minimal background, making it reliable for detecting the target protein in Western blot experiments.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Zhongwen (Verified Customer) (09-25-2023) | Clear band.
 |
Hannah (Verified Customer) (12-05-2018) | Single specific band detected at expected size after overnight primary incubation.
 |
