Tested Applications
| Positive WB detected in | A549 cells, HuH-7 cells, HeLa cells, rat brain tissue, mouse brain tissue |
| Positive IP detected in | A2780 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 18 publications below |
| WB | See 23 publications below |
| IHC | See 11 publications below |
| IF | See 3 publications below |
| RIP | See 1 publications below |
Product Information
14994-1-AP targets METTL1 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6980 Product name: Recombinant human METTL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-276 aa of BC000550 Sequence: MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH Predict reactive species |
| Full Name | methyltransferase like 1 |
| Calculated Molecular Weight | 31 kDa |
| Observed Molecular Weight | 31 kDa |
| GenBank Accession Number | BC000550 |
| Gene Symbol | METTL1 |
| Gene ID (NCBI) | 4234 |
| RRID | AB_2142013 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UBP6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
METTL1 methyltransferase mediates m7G methylation within miRNAs and regulates cell migration via its catalytic activity. METTL1 can be inactivated by phosphorylation at Ser27 by protein kinase B (PKBα). Overexpression of METTL1 is widely observed among human cancers. It is also crucial for the regulation of chemoresistance in cancer treatment. In addition, mutations in the human N7-methylguanosine (m7G) methyltransferase complex METTL1/WDR4 cause primordial dwarfism and brain malformation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for METTL1 antibody 14994-1-AP | Download protocol |
| IHC protocol for METTL1 antibody 14994-1-AP | Download protocol |
| IP protocol for METTL1 antibody 14994-1-AP | Download protocol |
| WB protocol for METTL1 antibody 14994-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Res Dynamic methylome of internal mRNA N7-methylguanosine and its regulatory role in translation. | ||
Mol Cell A methyltransferase-independent role for METTL1 in tRNA aminoacylation and oncogenic transformation
| ||
Mol Cell N7-Methylguanosine tRNA modification enhances oncogenic mRNA translation and promotes intrahepatic cholangiocarcinoma progression.
| ||
Mol Cell METTL1-mediated m7G modification of Arg-TCT tRNA drives oncogenic transformation.
| ||
Mol Cell Mettl1/Wdr4-Mediated m7G tRNA Methylome Is Required for Normal mRNA Translation and Embryonic Stem Cell Self-Renewal and Differentiation.
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Zhongwen (Verified Customer) (09-25-2023) | Clear band.
![]() |
FH Hannah (Verified Customer) (12-05-2018) | Single specific band detected at expected size after overnight primary incubation.
![]() |











