Tested Applications
| Positive WB detected in | human saliva tissue |
| Positive IP detected in | human saliva tissue |
| Positive IHC detected in | human tonsillitis tissue, human lung cancer tissue, human spleen tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27306-1-AP targets MMP-9 (Middle) in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26132 Product name: Recombinant human MMP9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 210-346 aa of BC006093 Sequence: WSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGEL Predict reactive species |
| Full Name | matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) |
| Calculated Molecular Weight | 707 aa, 78 kDa |
| Observed Molecular Weight | 92 kDa |
| GenBank Accession Number | BC006093 |
| Gene Symbol | MMP-9 |
| Gene ID (NCBI) | 4318 |
| RRID | AB_2880837 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P14780 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, tissue remodeling, and disease processes, such as arthritis or metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. Matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) (MMP9, synonyms: GELB, CLG4B) degrades collagens type IV and V. Studies in rhesus monkeys suggest that MMP9 is involved in IL-8-induced mobilization hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. The pro-MMP9 is 92 kDa, and it can be detected a processed form of 68 kDa or 82 kDa. This protein can exist as a dimer of 180 kDa (PMID:7492685).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MMP-9 (Middle) antibody 27306-1-AP | Download protocol |
| IP protocol for MMP-9 (Middle) antibody 27306-1-AP | Download protocol |
| WB protocol for MMP-9 (Middle) antibody 27306-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MMP-9 (Middle) Polyclonal antibody (Cat# 27306-1-AP) has accumulated 103 citations across diverse journals, including Nature Communications, Advanced Science, Oncogene, Gut Microbes, Journal of Controlled Release, International Journal of Biological Sciences, Molecular Therapy, Acta Biomaterialica, and Phytomedicine. Research fields span oncology (lung, breast, gastric, colorectal, liver cancers), cardiovascular disease (atherosclerosis, aneurysm), neurology, immunology and inflammation, tissue fibrosis, and natural product pharmacology.
| Species | Application | Title |
|---|---|---|
J Extracell Vesicles Engineered CAR-T-Derived Exosomes Co-Delivering miR-145 and Cytotoxic Proteins for Targeted Solid Tumour Therapy. | ||
Nat Commun Nano-functionalized probiotic treats atherosclerosis via inhibiting intestinal microbiota-TMA-TMAO axis. | ||
Gut Microbes Fusobacterium nucleatum-driven CX3CR1+ PD-L1+ phagocytes route to tumor tissues and reshape tumor microenvironment | ||
J Nanobiotechnology Platelet-hitchhike nanomedicine for theranostics of coronary artery dissection via X-CT imaging and inhibiting NLRP3 signaling pathway. | ||
Adv Sci (Weinh) Photothermal-Responsive Soluble Microneedle Patches for Meibomian Gland Dysfunction Therapy | ||
Adv Sci (Weinh) Glucagon Enhances Chemotherapy Efficacy By Inhibition of Tumor Vessels in Colorectal Cancer |
Reviews
What customers say
One reviewer rated this antibody 4/5 stars after using it for Western Blot at a 1:1000 dilution on liver tissue (lot 00053910). The comment was brief but positive: "good for western blot." Overall, the limited feedback suggests satisfactory performance for WB applications, though more reviews would provide broader insight into its reliability across different tissues and conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
MALLIKARJUNA (Verified Customer) (11-13-2025) | good for western blot
|
