Tested Applications
| Positive WB detected in | mouse brain tissue, mouse skeletal muscle tissue, rat brain tissue |
| Positive IHC detected in | rat Ischiadic nerve tissue, mouse Ischiadic nerve tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 12 publications below |
| IHC | See 1 publications below |
| IF | See 8 publications below |
| CoIP | See 1 publications below |
Product Information
10572-1-AP targets MPZ / P0 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, frog |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0848 Product name: Recombinant human MPZ,P0 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-258 aa of BC006491 Sequence: MLRAPAPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK Predict reactive species |
| Full Name | myelin protein zero |
| Calculated Molecular Weight | 28 kDa |
| Observed Molecular Weight | 28-30 kDa |
| GenBank Accession Number | BC006491 |
| Gene Symbol | MPZ |
| Gene ID (NCBI) | 4359 |
| RRID | AB_2144657 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P25189 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MPZ (myelin protein zero), also known as P0, is a transmembrane glycoprotein that belongs to the immunoglobulin supergene family. Synthesized by myelin-forming Schwann cells, MPZ is the major structural protein component of myelin in the peripheral nervous system. It is involved in the formation and maintenance of compact myelin and plays a role in the creation of an extracellular membrane face which guides the wrapping process and ultimately compacts adjacent lamellae. More than 120 mutations detected in the gene of MPZ cause various forms of hereditary neuropathy, which include Charcot-Marie-Tooth disease type 1B (CMT1B), CMT2, Dejerine-Sottas syndrome (DSS), and congenital hypomyelination neuropathy (CHN). This antibody can recognize endogenous MPZ and can be used as a marker of myelinating Schwann cells. MPZ can be detected the 25-30 kDa band by western blot. A band of 36 kDa could also be detected, which is a novel isoform of MPZ that contains an additional domain at the C-terminal (PMID: 22457349). It can also exist as a dimer (PMID: 12933931).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MPZ / P0 antibody 10572-1-AP | Download protocol |
| WB protocol for MPZ / P0 antibody 10572-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Oxid Med Cell Longev Neuroprotective Effect of Salvianolic Acid A against Diabetic Peripheral Neuropathy through Modulation of Nrf2. | ||
Front Cell Neurosci Protein kinase C epsilon activation regulates proliferation, migration, and epithelial to mesenchymal-like transition in rat Schwann cells | ||
Front Endocrinol (Lausanne) Clinical identification of expressed proteins in adrenal medullary hyperplasia detected with hypertension | ||
Stem Cell Res Ther Schwann cells promote prevascularization and osteogenesis of tissue-engineered bone via bone marrow mesenchymal stem cell-derived endothelial cells. | ||
Glia MMP-9 controls Schwann cell proliferation and phenotypic remodeling via IGF-1 and ErbB receptor-mediated activation of MEK/ERK pathway. | ||









