MSH6 Polyclonal antibody

• 

  WB analysis of HEK-293 using 18120-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 18120-1-AP (MSH6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 18120-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18120-1-AP (MSH6 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 18120-1-AP

  WB result of MSH6 antibody (18120-1-AP, 1:6000) with si-Control and si-MSH6 transfected HEK293 cells.

• 

  WB analysis of HEK-293 using 18120-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 18120-1-AP (MSH6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 18120-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 18120-1-AP (MSH6 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 18120-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 18120-1-AP (MSH6 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 18120-1-AP

  IP result of anti-MSH6 (IP:18120-1-AP, 4ug; Detection:18120-1-AP 1:600) with HEK-293 cells lysate 1120ug.

• 

  IHC staining of human colon using 18120-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 18120-1-AP (MSH6 antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 18120-1-AP

  Immunofluorescent analysis of Hela cells, using MSH6 antibody 18120-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

• 

  IF Staining of HeLa using 18120-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using MSH6 antibody (18120-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

MSH6 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 18120-1-AP

Publications(14)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

G/T mismatch binding protein, G/T mismatch-binding protein, GTBP, GTMBP, hMSH6

---

Tested Applications

• Positive WB detected in: HEK-293 cells, COLO 320 cells, HeLa cells, Caco-2 cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:800-1:3200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 10 publications below
• IHC: See 4 publications below
• IF: See 2 publications below
• IP: See 1 publications below

Product Information

18120-1-AP targets MSH6 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12645

  Product name: Recombinant human MSH6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-400 aa of BC004246

  Sequence: MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRRSSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKRKRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPE

• Full Name: mutS homolog 6 (E. coli)
• Calculated Molecular Weight: 153 kDa
• Observed Molecular Weight: 150-160 kDa
• GenBank Accession Number: BC004246
• Gene Symbol: MSH6
• Gene ID (NCBI): 2956
• RRID: AB_2250726
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52701
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MSH6, also named as DNA mismatch repair protein Msh6 or GTMBP, is a 1360 amino acid protein, which contains one PWWP domain and belongs to the DNA mismatch repair MutS family. MSH6 localizes in the nucleus and is a component of the post-replicative DNA mismatch repair system. Msh2 and Msh6 form a protein complex required to repair mismatches generated during DNA replication.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cancer; CircLIFR synergizes with MSH2 to attenuate chemoresistance via MutSα/ATM-p73 axis in bladder cancer.; Authors - Hui Zhang
human	IHC,IF	Commun Biol; EZH2 elicits CD8+ T-cell desert in esophageal squamous cell carcinoma via suppressing CXCL9 and dendritic cells; Authors - Chun-Yan Zhu
human	WB	Oncotarget; Targeted silencing of SOX2 by an artificial transcription factor showed antitumor effect in lung and esophageal squamous cell carcinoma.; Authors - Etsuko Yokota
human	IHC	Front Oncol; Molecular Classification in Patients With Endometrial Cancer After Fertility-Preserving Treatment: Application of ProMisE Classifier and Combination of Prognostic Evidence.; Authors - Xuting Ran
	WB	Mol Brain; TDP43 interacts with MLH1 and MSH6 proteins in a DNA damage-inducible manner; Authors - Vincent E Provasek
human	WB	DNA Cell Biol; MSH6 Aggravates the Hypoxic Microenvironment via Regulating HIF1A to Promote the Metastasis of Glioblastoma Multiforme.; Authors - Ying Shi