MSH6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MSH6 Polyclonal antibody (18120-1-AP)

• Featured Product
• KD/KO Validated

MSH6 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 18120-1-AP Copied!

Publications (18)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

G/T mismatch binding protein, G/T mismatch-binding protein, GTBP, GTMBP, hMSH6

• 

  WB analysis using 18120-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18120-1-AP (MSH6 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 18120-1-AP

  WB result of MSH6 antibody (18120-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MSH6 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of COLO 320 using 18120-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 18120-1-AP (MSH6 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 18120-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 18120-1-AP (MSH6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 18120-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 18120-1-AP (MSH6 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 18120-1-AP

  IP result of anti-MSH6 (IP:18120-1-AP, 4ug; Detection:18120-1-AP 1:600) with HEK-293 cells lysate 1120ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 18120-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 18120-1-AP (MSH6 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 18120-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 18120-1-AP (MSH6 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 18120-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 18120-1-AP (MSH6 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 18120-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 18120-1-AP (MSH6 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 18120-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 18120-1-AP (MSH6 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 18120-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 18120-1-AP (MSH6 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 18120-1-AP

  Immunofluorescent analysis of Hela cells, using MSH6 antibody 18120-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 18120-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using MSH6 antibody (18120-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MSH6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: COLO 320 cells, HEK-293 cells, HeLa cells, Caco-2 cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human tonsillitis tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18120-1-AP targets MSH6 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12645

  Product name: Recombinant human MSH6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-400 aa of BC004246

  Sequence: MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRRSSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKRKRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPE

• Full Name: mutS homolog 6 (E. coli)
• Calculated Molecular Weight: 153 kDa
• Observed Molecular Weight: 150-160 kDa
• GenBank Accession Number: BC004246
• Gene Symbol: MSH6
• Gene ID (NCBI): 2956
• RRID: AB_2250726
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52701
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MSH6, also named as DNA mismatch repair protein Msh6 or GTMBP, is a 1360 amino acid protein, which contains one PWWP domain and belongs to the DNA mismatch repair MutS family. MSH6 localizes in the nucleus and is a component of the post-replicative DNA mismatch repair system. Msh2 and Msh6 form a protein complex required to repair mismatches generated during DNA replication.

Publications

What published studies show

The anti-MSH6 antibody (Cat# 18120-1-AP) has 18 citations across 16 journals including Molecular Cancer, Nucleic Acids Research, Clinical Cancer Research, Journal for ImmunoTherapy of Cancer, Communications Biology, Oncotarget, and Frontiers in Oncology. Research fields span DNA mismatch repair, genome stability, and multiple cancer types (bladder, glioma, colorectal, hepatocellular, esophageal, endometrial, gastric), with applications in WB, IHC, IF, and IP.

Automatically generated from the 18 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cancer; CircLIFR synergizes with MSH2 to attenuate chemoresistance via MutSα/ATM-p73 axis in bladder cancer.; Authors - Hui Zhang
human	WB	Drug Resist Updat; Intercellular adhesion molecule-1 suppresses TMZ chemosensitivity in acquired TMZ-resistant gliomas by increasing assembly of ABCB1 on the membrane; Authors - Xin Zhang
mouse	WB	Nucleic Acids Res; Resolution of sequence divergence for repeat-mediated deletions shows a polarity that is mediated by MLH1; Authors - Hannah Trost
mouse,human	WB	Nucleic Acids Res; RNA/DNA-binding protein TDP43 regulates DNA mismatch repair genes with implications for genome stability.; Authors - Vincent E Provasek
human	WB	Cell Mol Biol Lett; MRE11A: a novel negative regulator of human DNA mismatch repair; Authors - Demin Du
human	WB	Int J Biol Sci; Targeting THOC2-Mediated mRNA Export Induces PARP Inhibitor Vulnerability in DNA Repair-Competent Hepatocellular Carcinoma.; Authors - Xinli Li