Tested Applications
| Positive WB detected in | HL-60 cells, Jurkat cells, MOLT-4 cells |
| Positive IP detected in | HL-60 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17800-1-AP targets MYB/c-Myb in WB, IF, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12021 Product name: Recombinant human MYB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-356 aa of BC064955 Sequence: MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPS Predict reactive species |
| Full Name | v-myb myeloblastosis viral oncogene homolog (avian) |
| Calculated Molecular Weight | 640 aa, 72 kDa |
| Observed Molecular Weight | 40-50 kDa, 72-80 kDa |
| GenBank Accession Number | BC064955 |
| Gene Symbol | c-Myb |
| Gene ID (NCBI) | 4602 |
| RRID | AB_2148029 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P10242 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The MYB protein is a transcription factor that plays a key role in regulating the proliferation/differentiation of progenitor cells in bone marrow, colonic crypts, and neurogenic niches [PMID:18574464]. It is involved in the regulation of epithelial-to-mesenchymal transition (EMT) and invasion in neuroblastoma, colon carcinoma, and embryonic kidney cells through the upregulation of the transcription repressor Slug [PMID:20622260]. It also a DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3', and plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells. MYB exists some isoforms with MV 85, 75, 72, 68, 63 and 40 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for MYB/c-Myb antibody 17800-1-AP | Download protocol |
| WB protocol for MYB/c-Myb antibody 17800-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-MYB antibody (Cat# 17800-1-AP) has 23 citations published in journals including Nature Communications, Nature Immunology, Cancer Cell, Nature Chemical Biology, Journal of Experimental & Clinical Cancer Research, Phytomedicine, International Journal of Biological Macromolecules, Molecular Systems Biology, Communications Biology, and others. Research fields span oncology (breast, prostate, colorectal, nasopharyngeal, esophageal, glioblastoma), immunology, hematology/megakaryopoiesis, ferroptosis, neurodegeneration, sepsis, and gene editing.
| Species | Application | Title |
|---|---|---|
Cancer Cell Genetic interactions reveal distinct biological and therapeutic implications in breast cancer | ||
Nat Immunol Tumor cell-released kynurenine biases MEP differentiation into megakaryocytes in individuals with cancer by activating AhR-RUNX1 | ||
Nat Commun Tcf1 and Lef1 provide constant supervision to mature CD8+ T cell identity and function by organizing genomic architecture. | ||
Nat Commun NLRP3 phosphorylation in its LRR domain critically regulates inflammasome assembly. | ||
Nat Commun Nucleotide-resolution mapping of regulatory elements via allelic readout of tiled base editing. | ||
Reviews
What customers say
This product has received one review with a 5-star rating. The reviewer, Bo Liu, used the antibody for Western Blot and reported that it performed well in their assay while being cost-effective. Overall, the feedback is positive, highlighting both reliable performance and good value for money.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Bo (Verified Customer) (09-02-2026) | Antibody works well in my assay, cost-effective.
|
