Tested Applications
| Positive WB detected in | Raji cells, HL-60 cells, MCF-7 cells, mouse heart tissue, mouse skeletal muscle tissue, RAW 264.7 cells, Ramos cells, mouse liver tissue, rat liver tissue |
| Positive IP detected in | mouse heart tissue |
| Positive IHC detected in | human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells, HeLa cells, U-87 MG cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11776-1-AP targets NAMPT/PBEF in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.
| Tested Reactivity | human, mouse, rat, zebrafish |
| Cited Reactivity | human, mouse, rat, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2434 Product name: Recombinant human NAMPT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC020691 Sequence: MNPAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRV Predict reactive species |
| Full Name | nicotinamide phosphoribosyltransferase |
| Calculated Molecular Weight | 52 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC020691 |
| Gene Symbol | NAMPT/PBEF |
| Gene ID (NCBI) | 10135 |
| RRID | AB_2298317 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P43490 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nicotinamide phosphoribosyltransferase(NAMPT) has two usual synonyms termed Visfatin and PBEF. Its primary role is to catalyze the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, an intermediate in the biosynthesis of NAD, which is the rate limiting component in the mammalian NAD biosynthesis pathway. NAMPT is expressed in large amounts in bone marrow, liver tissue, and muscle tissues. NAMPT inhibits neutrophil apoptosis in experimental inflammation and clinical sepsis. NAMPT levels are altered in plasma of patients with type 2 diabetes mellitus (T2DM), and it is now evidenced that NAMPT may plays a role in lipid metabolism.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NAMPT/PBEF antibody 11776-1-AP | Download protocol |
| IHC protocol for NAMPT/PBEF antibody 11776-1-AP | Download protocol |
| IP protocol for NAMPT/PBEF antibody 11776-1-AP | Download protocol |
| WB protocol for NAMPT/PBEF antibody 11776-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NAMPT/PBEF Polyclonal antibody (Cat# 11776-1-AP) has accumulated 96 citations in journals including Cancer Cell, Cell Metabolism, Neuron, Nature Cardiovascular Research, Advanced Science, EMBO Molecular Medicine, Cell Reports, and Redox Biology. Associated research fields encompass NAD⁺ metabolism, oncology (hepatocellular, breast, colorectal, glioma, and cervical cancers), cardiovascular disease, neurology, metabolic disorders such as NAFLD and diabetes, renal pathology, inflammation, aging, and immune regulation. Applications are predominantly Western blot, with IHC, IF, and IP also represented.
| Species | Application | Title |
|---|---|---|
Cancer Cell Inhibition of De Novo NAD(+) Synthesis by Oncogenic URI Causes Liver Tumorigenesis through DNA Damage. | ||
Cell Metab NAD+ Metabolism Maintains Inducible PD-L1 Expression to Drive Tumor Immune Evasion.
| ||
Cell Metab AARS1 promotes tumor progression and immune evasion via ATF6 lactylation-mediated tryptophan metabolism in hepatocellular carcinoma | ||
Adv Mater Dual Single-Atom Engineered NADH Oxidase-Mimic Boosts In Situ NAD(+) Biotransformation for Targeted Myocardial Ischemia/Reperfusion Protection. | ||
Metabolism Hyperglycemia-reduced NAD+ biosynthesis impairs corneal epithelial wound healing in diabetic mice.
|
Reviews
What customers say
Customers report this antibody performs well across Western Blot, Immunohistochemistry, and Immunofluorescence applications. Recommended dilutions range from 1:100 to 1:1000 depending on the assay. Users confirmed effective targeting in human, mouse, rat, and zebrafish samples, including liver tissues and epithelial cells. One reviewer noted some background binding in WB with mitochondrial muscle preparations, suggesting optimization of blocking conditions may be needed. Overall, the antibody is described as reliable and effective for its intended applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Lenie (Verified Customer) (07-04-2025) | Included in WB (mitochondrial muscle preparation, dry blotting, used 5% milk in TBST as blocking, jad a lot of background binding) and IF (on a freeze dried sample on muscles)
 |
DAN (Verified Customer) (03-11-2022) | Very effective in getting targeted efficacy.
|
kishu (Verified Customer) (06-10-2021) | this Ab works well for WB (1:100) and IHC (1:200)
|
Iru (Verified Customer) (05-30-2019) | This antibody works really well.
|
