• Featured Product
  • KD/KO Validated

NAMPT/PBEF Polyclonal antibody

NAMPT/PBEF Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 11776-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, zebrafish

Applications

WB, IHC, IF/ICC, IP, ELISA

Nampt, Visfatin, EC:2.4.2.12, NAmPRTase, PBEF

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat liver tissue, HL-60 cells, MCF-7 cells, mouse heart tissue, mouse liver tissue, mouse skeletal muscle tissue, Ramos cells, RAW 264.7 cells
Positive IP detected inmouse heart tissue
Positive IHC detected inhuman lymphoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells, HeLa cells, U-87 MG cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11776-1-AP targets NAMPT/PBEF in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.

Tested Reactivity human, mouse, rat, zebrafish
Cited Reactivityhuman, mouse, rat, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2434

Product name: Recombinant human NAMPT protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC020691

Sequence: MNPAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRV

Predict reactive species
Full Name nicotinamide phosphoribosyltransferase
Calculated Molecular Weight 52 kDa
Observed Molecular Weight 50-55 kDa
GenBank Accession NumberBC020691
Gene Symbol NAMPT/PBEF
Gene ID (NCBI) 10135
RRIDAB_2298317
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP43490
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nicotinamide phosphoribosyltransferase(NAMPT) has two usual synonyms termed Visfatin and PBEF. Its primary role is to catalyze the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, an intermediate in the biosynthesis of NAD, which is the rate limiting component in the mammalian NAD biosynthesis pathway. NAMPT is expressed in large amounts in bone marrow, liver tissue, and muscle tissues. NAMPT inhibits neutrophil apoptosis in experimental inflammation and clinical sepsis. NAMPT levels are altered in plasma of patients with type 2 diabetes mellitus (T2DM), and it is now evidenced that NAMPT may plays a role in lipid metabolism.

Protocols

Product Specific Protocols
IF protocol for NAMPT/PBEF antibody 11776-1-APDownload protocol
IHC protocol for NAMPT/PBEF antibody 11776-1-APDownload protocol
IP protocol for NAMPT/PBEF antibody 11776-1-APDownload protocol
WB protocol for NAMPT/PBEF antibody 11776-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cancer Cell

Inhibition of De Novo NAD(+) Synthesis by Oncogenic URI Causes Liver Tumorigenesis through DNA Damage.

Authors - Krishna S Tummala
mouse,humanWB,IHC

Cell Metab

NAD+ Metabolism Maintains Inducible PD-L1 Expression to Drive Tumor Immune Evasion.

Authors - Hongwei Lv
  • KD Validated
humanWB

Acta Pharm Sin B

Thermal proteome profiling (TPP) reveals NAMPT as the anti-glioma target of phenanthroindolizidine alkaloid PF403

Authors - Fangfei Li
mouseWB,IHC

Cell Death Dis

Astrocyte-derived exosomal nicotinamide phosphoribosyltransferase (Nampt) ameliorates ischemic stroke injury by targeting AMPK/mTOR signaling to induce autophagy

Authors - Yang Deng
mouse,humanWB,IHC

Int J Mol Sci

NAD+ Anabolism Disturbance Causes Glomerular Mesangial Cell Injury in Diabetic Nephropathy.

Authors - Xue Li
mouse,humanWB,IF

Metabolism

Hyperglycemia-reduced NAD+ biosynthesis impairs corneal epithelial wound healing in diabetic mice.

Authors - Ya Li
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Lenie (Verified Customer) (07-04-2025)

Included in WB (mitochondrial muscle preparation, dry blotting, used 5% milk in TBST as blocking, jad a lot of background binding) and IF (on a freeze dried sample on muscles)

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1/200 (IF) and 1/1000 (WB)
  • Cell Tissue Type: Zebrafish
NAMPT/PBEF Antibody Western Blot,Immunofluorescence validation (1/200 (IF) and 1/1000 (WB) dilution) in Zebrafish (Cat no:11776-1-AP)
FH

DAN (Verified Customer) (03-11-2022)

Very effective in getting targeted efficacy.

  • Applications: Western Blot
  • Cell Tissue Type: Human, Mouse, Rat
FH

kishu (Verified Customer) (06-10-2021)

this Ab works well for WB (1:100) and IHC (1:200)

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1;1000
  • Cell Tissue Type: mouse liver tissues and rat liver
FH

Iru (Verified Customer) (05-30-2019)

This antibody works really well.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: fallopian tube epithelial cells
Loading...
||
New chat Able
正在加载,请稍候...