Tested Applications
Positive WB detected in | HepG2 cells, L02 cells, HeLa cells, human placenta tissue |
Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
27488-1-AP targets NDNL2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26663 Product name: Recombinant human NDNL2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC053999 Sequence: MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSRGPGGSQGSQGPSPQGARRAQAAPAVGPRSQKQLELKVS Predict reactive species |
Full Name | necdin-like 2 |
Calculated Molecular Weight | 34 kDa |
Observed Molecular Weight | 38 kDa |
GenBank Accession Number | BC053999 |
Gene Symbol | NDNL2 |
Gene ID (NCBI) | 56160 |
RRID | AB_2880885 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96MG7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NDNL2 (also known as NSMCE3 or MAGEG1) is a part of the SMC5-6 protein complex that is essential for DNA damage response and chromosome segregation (PMID: 18086888; 27427983). The gene of human NDNL2 maps to chromosome 15q13.1. Northern blot analysis detected expression of a 1.9-kb transcript in all human tissues tested, with highest expression in testis (PMID: 11782285). Missense mutations in NSMCE3 have been associated with an autosomal recessive chromosome breakage syndrome that leads to defective T and B cell function and acute respiratory distress syndrome in early childhood (PMID: 27427983).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NDNL2 antibody 27488-1-AP | Download protocol |
IHC protocol for NDNL2 antibody 27488-1-AP | Download protocol |
IF protocol for NDNL2 antibody 27488-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |