Tested Applications
| Positive WB detected in | HepG2 cells, L02 cells, HeLa cells, human placenta tissue |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
27488-1-AP targets NDNL2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26663 Product name: Recombinant human NDNL2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC053999 Sequence: MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSRGPGGSQGSQGPSPQGARRAQAAPAVGPRSQKQLELKVS Predict reactive species |
| Full Name | necdin-like 2 |
| Calculated Molecular Weight | 34 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC053999 |
| Gene Symbol | NDNL2 |
| Gene ID (NCBI) | 56160 |
| RRID | AB_2880885 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96MG7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NDNL2 (also known as NSMCE3 or MAGEG1) is a part of the SMC5-6 protein complex that is essential for DNA damage response and chromosome segregation (PMID: 18086888; 27427983). The gene of human NDNL2 maps to chromosome 15q13.1. Northern blot analysis detected expression of a 1.9-kb transcript in all human tissues tested, with highest expression in testis (PMID: 11782285). Missense mutations in NSMCE3 have been associated with an autosomal recessive chromosome breakage syndrome that leads to defective T and B cell function and acute respiratory distress syndrome in early childhood (PMID: 27427983).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NDNL2 antibody 27488-1-AP | Download protocol |
| IHC protocol for NDNL2 antibody 27488-1-AP | Download protocol |
| WB protocol for NDNL2 antibody 27488-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |













