NDNL2 Polyclonal antibody

• 

  WB analysis of HepG2 using 27488-1-AP

  HepG2, L02 and HeLa cells were subjected to SDS PAGE followed by western blot with 27488-1-AP (NDNL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 27488-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 27488-1-AP (NDNL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 27488-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 27488-1-AP (NDNL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 27488-1-AP

  HepG2 cells and human placenta tissue were subjected to SDS PAGE followed by western blot with 27488-1-AP (NDNL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 27488-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27488-1-AP (NDNL2 antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 27488-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27488-1-AP (NDNL2 antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 27488-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using NDNL2 antibody (27488-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

NDNL2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27488-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

HCA4, Hepatocellular carcinoma-associated protein 4, MAGEG1, MAGE-G1 antigen, Melanoma-associated antigen G1

---

Tested Applications

• Positive WB detected in: HepG2 cells, L02 cells, HeLa cells, human placenta tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

27488-1-AP targets NDNL2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26663

  Product name: Recombinant human NDNL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-90 aa of BC053999

  Sequence: MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSRGPGGSQGSQGPSPQGARRAQAAPAVGPRSQKQLELKVS

• Full Name: necdin-like 2
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC053999
• Gene Symbol: NDNL2
• Gene ID (NCBI): 56160
• RRID: AB_2880885
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96MG7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDNL2 (also known as NSMCE3 or MAGEG1) is a part of the SMC5-6 protein complex that is essential for DNA damage response and chromosome segregation (PMID: 18086888; 27427983). The gene of human NDNL2 maps to chromosome 15q13.1. Northern blot analysis detected expression of a 1.9-kb transcript in all human tissues tested, with highest expression in testis (PMID: 11782285). Missense mutations in NSMCE3 have been associated with an autosomal recessive chromosome breakage syndrome that leads to defective T and B cell function and acute respiratory distress syndrome in early childhood (PMID: 27427983).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Rep; Epstein-Barr virus BNRF1 destabilizes SMC5/6 cohesin complexes to evade its restriction of replication compartments.; Authors - Stephanie Pei Tung Yiu