Featured Product
KD/KO Validated

NDUFS3 Polyclonal antibody

NDUFS3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15066-1-AP

Publications (45)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

CI 30kD, CI30kD, CI-30kD, Complex I-30kD, EC:7.1.1.2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF/ICC

WB analysis using 15066-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 15066-1-AP (NDUFS3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 15066-1-AP
WB result of NDUFS3 antibody (15066-1-AP; 1:5000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NDUFS3 transfected HEK-293 cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 15066-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 15066-1-AP (NDUFS3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of mouse heart using 15066-1-AP
IP result of anti-NDUFS3 (IP:15066-1-AP, 4ug; Detection:15066-1-AP 1:500) with mouse heart tissue lysate 4000ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse testis using 15066-1-AP
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15066-1-AP (NDUFS3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 15066-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using NDUFS3 antibody (15066-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 15066-1-AP
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using NDUFS3 antibody (15066-1-AP) at dilution of 1:100 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CoraLite®594-Phalloidin (red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NDUFS3 in ?

Overview

Tested Applications
Product Information
Publications (45)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HEK-293T cells, HEK-293 cells, HepG2 cells, NIH/3T3 cells, mouse heart tissue, rat brain tissue, mouse brain tissue, rat heart tissue
Positive IP detected in	mouse heart tissue
Positive IHC detected in	mouse testis tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:2000-1:10000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15066-1-AP targets NDUFS3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat, pig
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag7072 Product name: Recombinant human NDUFS3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-264 aa of BC000617 Sequence: MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK Predict reactive species
Full Name	NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase)
Calculated Molecular Weight	30 kDa
Observed Molecular Weight	30 kDa
GenBank Accession Number	BC000617
Gene Symbol	NDUFS3
Gene ID (NCBI)	4722
RRID	AB_2151109
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O75489
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFS3(NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial) is also named as CI-30kD and belongs to the complex I 30 kDa subunit family. It catalyzes the oxidation of NADH, with the concomitant reduction of ubiquinone and ejection of protons out of the mitochondria(PMID:10967146). NDUFS3 can be used as a mitochondrial matrix control(PMID:17344420). The full length has a transit peptide with 36 amino acids.

Protocols

Product Specific Protocols
IF protocol for NDUFS3 antibody 15066-1-AP	Download protocol
IHC protocol for NDUFS3 antibody 15066-1-AP	Download protocol
IP protocol for NDUFS3 antibody 15066-1-AP	Download protocol
WB protocol for NDUFS3 antibody 15066-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The NDUFS3 Polyclonal antibody (Cat# 15066-1-AP) has 45 citations. Journals include Cell, Cancer Discovery, Nature Communications, Neuron, Molecular Cell, Theranostics, Advanced Science, Cell Reports Medicine, Science Advances, Diabetes, Journal of Biological Chemistry, Scientific Reports, and EMBO Reports. Research fields span mitochondrial biology and oxidative phosphorylation, cancer (renal, pancreatic, lung, glioblastoma, myeloma), neurodegeneration (Alzheimer's, Parkinson's, tau pathology), diabetes, iron homeostasis, and mitochondrial disease. Applications are primarily Western blot, IHC, IF, and IP.

Species	Application	Title
human	WB	Cell Engineering mtDNA deletions by reconstituting end joining in human mitochondria Authors - Yi Fu View Article
human	WB,IHC	Cancer Discov NCOA4-Mediated Ferritinophagy Is a Pancreatic Cancer Dependency via Maintenance of Iron Bioavailability for Iron-Sulfur Cluster Proteins Authors - Naiara Santana-Codina View Article
human	WB	Cancer Discov Copper Drives Remodeling of Metabolic State and Progression of Clear Cell Renal Cell Carcinoma Authors - Megan E Bischoff View Article
		Nat Commun Maternal obesity induces macrophage to myofibroblast transition in kidneys of male offspring through a pathway driven by 20-hydroxyeicosatetraenoic acid. Authors - Fengbo Zhong View Article
		Neuron Tau-induced mitochondrial reverse electron transport drives neurodegeneration. Authors - Wen Li View Article
human	WB	Mol Cell Maintaining Iron Homeostasis Is the Key Role of Lysosomal Acidity for Cell Proliferation. Authors - Ross A Weber View Article