• Featured Product
  • KD/KO Validated

NFATC2 Polyclonal antibody

NFATC2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 22023-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

NFAT1, NFATP, NF ATc2, NF ATp, NFAT pre existing subunit

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells
Positive IP detected inJurkat cells
Positive IHC detected inhuman breast cancer tissue, human colon cancer tissue, human lymphoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU-251 cells
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22023-1-AP targets NFATC2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16849

Product name: Recombinant human NFATC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-302 aa of BC136418

Sequence: MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGSAV

Predict reactive species
Full Name nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
Calculated Molecular Weight 925 aa, 100 kDa
Observed Molecular Weight 135 kDa
GenBank Accession NumberBC136418
Gene Symbol NFATC2
Gene ID (NCBI) 4773
RRIDAB_2878973
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13469
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nuclear factor of activated T-cells, cytoplasmic 2 (NFATC2), also named NFAT1, or NFATP, is a 925 amino acid protein, which is expressed in thymus, spleen, heart, testis, brain, placenta, muscle and pancreas. Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription. NFATC2 plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2, IL-3, IL-4, TNF-alpha or GM-CSF. NFATC2 promotes invasive migration through the activation of GPC6 expression and WNT5A signaling pathway. The calculated molecular weight of NFATC2 is about 97-100 kDa, but the modified NFATC2 protein is about 135 kDa.

Protocols

Product Specific Protocols
FC protocol for NFATC2 antibody 22023-1-APDownload protocol
IF protocol for NFATC2 antibody 22023-1-APDownload protocol
IHC protocol for NFATC2 antibody 22023-1-APDownload protocol
IP protocol for NFATC2 antibody 22023-1-APDownload protocol
WB protocol for NFATC2 antibody 22023-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IF

Biomaterials

Targeted regulation of lymphocytic ER stress response with an overall immunosuppression to alleviate allograft rejection.

Authors - Yingying Shi
humanWB,IF

Breast Cancer Res

Calcium-sensing stromal interaction molecule 2 upregulates nuclear factor of activated T cells 1 and transforming growth factor-β signaling to promote breast cancer metastasis.

Authors - Yutian Miao
  • KD Validated
humanWB,IHC

Cell Mol Gastroenterol Hepatol

ANKRD22 Drives Rapid Proliferation of Lgr5+ Cells and Acts as a Promising Therapeutic Target in Gastric Mucosal Injury.

Authors - Jingwen Liu
IF

Mucosal Immunol

IL-33/ST2/IL-9/IL-9R signaling disrupts ocular surface barrier in allergic inflammation.

Authors - Jiaoyue Hu
humanWB

Mol Oncol

Ryanodine receptor 2 promotes colorectal cancer metastasis by the ROS/BACH1 axis

Authors - Tianwei Chen
mouseWB

J Neuroinflammation

Human PMSCs-derived small extracellular vesicles alleviate neuropathic pain through miR-26a-5p/Wnt5a in SNI mice model

Authors - Yitian Lu
Loading...
||
New chat Able
正在加载,请稍候...