Tested Applications
| Positive WB detected in | Jurkat cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human breast cancer tissue, human colon cancer tissue, human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U-251 cells |
| Positive FC (Intra) detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22023-1-AP targets NFATC2 in WB, IHC, IF/ICC, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16849 Product name: Recombinant human NFATC2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC136418 Sequence: MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGSAV Predict reactive species |
| Full Name | nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 |
| Calculated Molecular Weight | 925 aa, 100 kDa |
| Observed Molecular Weight | 135 kDa |
| GenBank Accession Number | BC136418 |
| Gene Symbol | NFATC2 |
| Gene ID (NCBI) | 4773 |
| RRID | AB_2878973 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13469 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nuclear factor of activated T-cells, cytoplasmic 2 (NFATC2), also named NFAT1, or NFATP, is a 925 amino acid protein, which is expressed in thymus, spleen, heart, testis, brain, placenta, muscle and pancreas. Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription. NFATC2 plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2, IL-3, IL-4, TNF-alpha or GM-CSF. NFATC2 promotes invasive migration through the activation of GPC6 expression and WNT5A signaling pathway. The calculated molecular weight of NFATC2 is about 97-100 kDa, but the modified NFATC2 protein is about 135 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for NFATC2 antibody 22023-1-AP | Download protocol |
| IF protocol for NFATC2 antibody 22023-1-AP | Download protocol |
| IHC protocol for NFATC2 antibody 22023-1-AP | Download protocol |
| IP protocol for NFATC2 antibody 22023-1-AP | Download protocol |
| WB protocol for NFATC2 antibody 22023-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-NFAT antibody (Cat# 22023-1-AP) has 37 citations published in journals including Advanced Materials, Kidney International, Cell Death & Disease, Journal of Nanobiotechnology, Brain, Behavior, and Immunity, Biochemical Pharmacology, Molecular Oncology, and Annals of Surgical Oncology. Research fields span oncology (breast, gastric, melanoma, colorectal, pancreatic, ovarian, and renal cancers), neuroscience (Parkinson's disease, neuropathic pain), immunology (lupus, allograft rejection), cardiology, nephrology, diabetes, wound healing, and respiratory medicine.
| Species | Application | Title |
|---|---|---|
Adv Mater Engineering a Lipid Nanoparticle with Atypical Calcium Crystal Structure for Enhanced IFNβ-Mediated Immunotherapy | ||
Adv Mater Multifunctional Injectable Hydrogel as a Biomimic Lens: Optical-Mechanical Restoration and Dynamic Postoperative Microenvironment Regulation. | ||
Kidney Int Non-canonical Wnt/calcium signaling is protective against podocyte injury and glomerulosclerosis
| ||
J Nanobiotechnology Enhancing antitumor immunity in triple-negative breast cancer through reversal of T-cell exhaustion using a CD8-targeted and membrane-camouflaged nanocarrier delivering small interfering RNA against sorting Nexin 9. | ||
J Nanobiotechnology Porphyromonas gingivalis extracellular vesicles promotes tumor metastasis in esophageal squamous cell carcinoma by inducing PRKACB/JNK/ NFATC2 axis.
| ||
Biomaterials Targeted regulation of lymphocytic ER stress response with an overall immunosuppression to alleviate allograft rejection. |
