Tested Applications
| Positive WB detected in | Jurkat cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human breast cancer tissue, human colon cancer tissue, human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U-251 cells |
| Positive FC (Intra) detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 17 publications below |
| IHC | See 3 publications below |
| IF | See 11 publications below |
Product Information
22023-1-AP targets NFATC2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16849 Product name: Recombinant human NFATC2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC136418 Sequence: MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGSAV Predict reactive species |
| Full Name | nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 |
| Calculated Molecular Weight | 925 aa, 100 kDa |
| Observed Molecular Weight | 135 kDa |
| GenBank Accession Number | BC136418 |
| Gene Symbol | NFATC2 |
| Gene ID (NCBI) | 4773 |
| RRID | AB_2878973 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13469 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nuclear factor of activated T-cells, cytoplasmic 2 (NFATC2), also named NFAT1, or NFATP, is a 925 amino acid protein, which is expressed in thymus, spleen, heart, testis, brain, placenta, muscle and pancreas. Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription. NFATC2 plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2, IL-3, IL-4, TNF-alpha or GM-CSF. NFATC2 promotes invasive migration through the activation of GPC6 expression and WNT5A signaling pathway. The calculated molecular weight of NFATC2 is about 97-100 kDa, but the modified NFATC2 protein is about 135 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for NFATC2 antibody 22023-1-AP | Download protocol |
| IF protocol for NFATC2 antibody 22023-1-AP | Download protocol |
| IHC protocol for NFATC2 antibody 22023-1-AP | Download protocol |
| IP protocol for NFATC2 antibody 22023-1-AP | Download protocol |
| WB protocol for NFATC2 antibody 22023-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biomaterials Targeted regulation of lymphocytic ER stress response with an overall immunosuppression to alleviate allograft rejection. | ||
Breast Cancer Res Calcium-sensing stromal interaction molecule 2 upregulates nuclear factor of activated T cells 1 and transforming growth factor-β signaling to promote breast cancer metastasis.
| ||
Cell Mol Gastroenterol Hepatol ANKRD22 Drives Rapid Proliferation of Lgr5+ Cells and Acts as a Promising Therapeutic Target in Gastric Mucosal Injury. | ||
Mucosal Immunol IL-33/ST2/IL-9/IL-9R signaling disrupts ocular surface barrier in allergic inflammation. | ||
Mol Oncol Ryanodine receptor 2 promotes colorectal cancer metastasis by the ROS/BACH1 axis | ||
J Neuroinflammation Human PMSCs-derived small extracellular vesicles alleviate neuropathic pain through miR-26a-5p/Wnt5a in SNI mice model |





















