Use Able AI chat for product recommendations

NFKB1 p105/p50 Monoclonal antibody

NFKB1 p105/p50 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 66992-1-Ig
Clone No.2G1E3

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), ChIP, ELISA

NFKB1, 2G1E3, DNA binding factor KBF1, DNA-binding factor KBF1, EBP 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HeLa cells, Jurkat cells, K-562 cells, THP-1 cells
Positive IHC detected inhuman stomach cancer tissue, human appendicitis tissue, human breast cancer tissue, human colon cancer tissue, human lymphoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66992-1-Ig targets NFKB1 p105/p50 in WB, IHC, IF/ICC, FC (Intra), ChIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5832

Product name: Recombinant human NFKB1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-370 aa of BC051765

Sequence: MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPN

Predict reactive species
Full Name nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
Calculated Molecular Weight 105 kDa
Observed Molecular Weight 50 kDa, 105 kDa
GenBank Accession NumberBC051765
Gene Symbol NFKB1
Gene ID (NCBI) 4790
RRIDAB_2882309
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP19838
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NFkB is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NFkB is activated by various intra- and extracellular stimuli such as cytokines, oxidant free radicals, ultraviolet irradiation, and bacterial or viral products. NFkB is a family of transcription factors that consists of homo- and heterodimers of NFkB1/p50 and RelA/p65 subunits, and controls a variety of cellular events including development and immune responses. All members share a conserved amino terminus domain that includes dimerization, nuclear localization, and DNA binding regions, and a carboxy terminal transactivation domain. Serines 529 and 536 in the transactivation domain of RelA/p65 are phosphorylated in response to several stimuli including phorbol ester, IL1 alpha and TNF alpha as mediated by IkB kinase and p38 MAPK. Phosphorylation of serines 529 and 536 is critical for RelA/p65 transcriptional activity. Activated NFkB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFkB has been associated with a number of inflammatory diseases while persistent inhibition of NFkB leads to inappropriate immune cell development or delayed cell growth. NFKB1 appears to have dual functions such as cytoplasmic retention of attached NF-kappa-B proteins by p105 and generation of p50 by a cotranslational processing. This antibody can bind both p105 and p50 isoforms of NFKB1.

Protocols

Product Specific Protocols
FC protocol for NFKB1 p105/p50 antibody 66992-1-IgDownload protocol
IF protocol for NFKB1 p105/p50 antibody 66992-1-IgDownload protocol
IHC protocol for NFKB1 p105/p50 antibody 66992-1-IgDownload protocol
WB protocol for NFKB1 p105/p50 antibody 66992-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Commun Biol

EZH2 elicits CD8+ T-cell desert in esophageal squamous cell carcinoma via suppressing CXCL9 and dendritic cells

Authors - Chun-Yan Zhu
mouseIF

J Ethnopharmacol

Sub-chronic exposure to realgar induces liver injury via upregulating the TXNIP/NLRP3 pathway and disturbing bile acid homeostasis in mice

Authors - Aihong Li
mouseWB

Chem Biol Drug Des

Caffeic acid-grafted chitooligosaccharides downregulate MAPK and NF-kB in RAW264.7 cells

Authors - Van-Hoai Bui
humanWB

Ecotoxicol Environ Saf

Arsenic-induced circASXL1 regulates 16HBE cell proliferation through the P65 signaling axis

Authors - Xuefei Yang
humanWB

Biochem Pharmacol

Fenticonazole targets NF-κB p105/p50 to suppress triple-negative breast cancer via ROS-mediated ER stress and apoptosis.

Authors - Xiaoling Cheng
humanIF

Circ Res

Spatiotemporal ATF3 Expression Determines VSMC Fate in Abdominal Aortic Aneurysm

Authors - Ying Wen
Loading...
||
New chat

Able

正在加载,请稍候...