Use Able AI chat for product recommendations

NME1+NME2 Polyclonal antibody

NME1+NME2 Polyclonal Antibody for WB, ELISA

Cat No. 33046-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

C-myc purine-binding transcription factor PUF, EC:2.7.13.3, EC:2.7.4.6, Histidine protein kinase NDKB, NDK A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HEK-293T cells, HT-1080 cells, HeLa cells, HepG2 cells, MCF-7 cells, Jurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

33046-1-AP targets NME1+NME2 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag37892

Product name: Recombinant human NME1-NME2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 26-140 aa of BC107894

Sequence: MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRT

Predict reactive species
Full Name NME1-NME2 readthrough transcript
Calculated Molecular Weight17 kDa / 20 kDa
Observed Molecular Weight17 kDa, 20 kDa
GenBank Accession NumberBC107894
Gene Symbol NME1-NME2
Gene ID (NCBI) 654364
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDP22392
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NME1 and NME2 are associated with metastatic tumor suppression. NME1 and NME2 are multispecificity kinases phosphorylating serine, threonine, histidine, and aspartic acid residues of substrate proteins (PMID: 39032654). NME1 can catalyze the transfer of the terminal phosphate group of nucleoside triphosphates to nucleoside diphosphates to generate nucleoside triphosphates, which is crucial for DNA synthesis and repair. It also participates in cell signal transduction, proliferation, differentiation, and apoptosis. Reduced expression of NME1 is associated with increased tumor metastasis. For instance, in breast cancer, gastric cancer, and other malignancies, restoring NME1 expression can inhibit tumor invasion and metastasis. Similar to NME1, NME2 possesses nucleoside diphosphate kinase activity, participating in nucleotide metabolism and cell signaling regulation. It can form hexameric complexes with NME1 and also exists as homohexamers. Its functions overlap with those of NME1 to some extent but also exhibit unique roles in certain physiological processes. NME2 is involved in tumor metastasis regulation. However, its expression changes and specific mechanisms in different cancers may vary. In some tumors, NME2 expression is downregulated, while in others, it may be upregulated. For example, in hepatocellular carcinoma, reduced NME2 expression is associated with tumor progression and poor prognosis, whereas in ovarian cancer, elevated NME2 expression may promote tumor cell proliferation and metastasis.

Protocols

Product Specific Protocols
WB protocol for NME1+NME2 antibody 33046-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...