NPNT Polyclonal antibody, PBS Only

• 

  WB analysis using 30836-1-AP (same clone as 30836-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30836-1-AP (NPNT antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30836-1-PBS in a different storage buffer formulation.

NPNT Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30836-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

30836-1-PBS targets NPNT in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34341

  Product name: Recombinant human NPNT protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 369-527 aa of BC166654

  Sequence: TVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFEIERGVSADDEAKDDPGVLVHSCNFDHGLCGWIREKDNDLHWEPIRDPAGGQYLTVSAAKAPGGKAARLVLPLGRLMHSGDLCLSFRHKVTGLHSGTLQVFVRKHGAHGAALWGRNGGHGWRQTQITL

• Full Name: nephronectin
• Calculated Molecular Weight: 62 kDa
• Observed Molecular Weight: 62-70kDa
• GenBank Accession Number: BC166654
• Gene Symbol: NPNT
• Gene ID (NCBI): 255743
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXI9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.