Tested Applications
| Positive WB detected in | HepG2 cells, MCF-7 cells, MDA-MB-231 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25055-1-AP targets NR1H4 in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21878 Product name: Recombinant human NR1H4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-121 aa of BC130573 Sequence: MGSKMNLIEHSHLPTTDEFSFSENLFGVLTEQVAGPLGQNLEVEPYSQYSNVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTKKPRMGASAGRI Predict reactive species |
| Full Name | nuclear receptor subfamily 1, group H, member 4 |
| Calculated Molecular Weight | 486 aa, 56 kDa |
| Observed Molecular Weight | 48-56 kDa |
| GenBank Accession Number | BC130573 |
| Gene Symbol | NR1H4 |
| Gene ID (NCBI) | 9971 |
| RRID | AB_2879874 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96RI1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nuclear Receptor subfamily 1, group H, member 4 (NR1H4, also known as FXR) is a receptor for bile acids and has an important role in regulating energy metabolism in liver, muscle and adipose tissues in humans and animals. NR1H4 is highly expressed in liver and has a role in lipid metabolism, whereas none of the other protein-coding genes in the region has known biological links with cholesterol, further supporting a role for NR1H4 in regulation of cholesterol levels. NR1H4 have five isoforms, each isoform has a different expressional level and transcriptional activity depending on its location within specific tissues. (PMID: 14733360, PMID: 30787420)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for NR1H4 antibody 25055-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Cell Metab Hepatic FXR-FGF4 is required for bile acid homeostasis via an FGFR4-LRH-1 signal node under cholestatic stress | ||
Cell Host Microbe A gut microbiota-bile acid axis promotes intestinal homeostasis upon aspirin-mediated damage | ||
Cell Host Microbe Dietary fiber alleviates alcoholic liver injury via Bacteroides acidifaciens and subsequent ammonia detoxification
| ||
J Adv Res Natural small molecule hinokitone mitigates NASH fibrosis by targeting regulation of FXR-mediated hepatocyte apoptosis
| ||
J Adv Res Tailoring obeticholic acid activity by iridium(III) complex conjugation to develop a farnesoid X receptor probe | ||
J Adv Res Hyodeoxycholic acid relieves neuropathic pain by activating farnesoid X receptor signaling. |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Bryce (Verified Customer) (04-16-2021) | Antibody did not work for mouse kidney homogenates. There was no observable difference between kidneys from wild type and knockout mice. Genotypes of blotted samples were confirmed by RT-qPCR.
 |
