• Featured Product
  • KD/KO Validated

NR5A2 Polyclonal antibody

NR5A2 Polyclonal Antibody for WB, ELISA
Cat No. 22460-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA

Alpha-1-fetoprotein transcription factor, B1 binding factor, B1-binding factor, B1F, B1F2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, rat testis tissue, mouse ovary tissue, BxPC-3 cells, mouse liver tissue, mouse pancreas tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22460-1-AP targets NR5A2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18001

Product name: Recombinant human NR5A2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 143-332 aa of BC118652

Sequence: NGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLL

Predict reactive species
Full Name nuclear receptor subfamily 5, group A, member 2
Calculated Molecular Weight 541 aa, 61 kDa
Observed Molecular Weight 61-67 kDa
GenBank Accession NumberBC118652
Gene Symbol NR5A2
Gene ID (NCBI) 2494
RRIDAB_2879108
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDO00482
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NR5A2 belongs to the nuclear hormone receptor family NR5 subfamily.It binds to the sequence element 5'-AACGACCGACCTTGAG-3' of the enhancer II of hepatitis B virus genes, a critical cis-element of their expression and regulation.NR5A2 may be responsible for the liver-specific activity of enhancer II, probably in combination with other hepatocyte transcription factors. Key regulator of cholesterol 7-alpha-hydroxylase gene (CYP7A) expression in liver. It may also contribute to the regulation of pancreas-specific genes and play important roles in embryonic development. LRH-1 is phosphorylated to display its normal function, including its role in the intriguing potential responses to phospholipid or other ligands. The hinge domain serine residues at 238 and 243 are required for effective phosphorylation, both in vitro and in cells (16439367).NR5A1 is abundantly expressed in pancreas, less in liver, very low levels in heart and lung. Expressed in hepG2. Isoform 1 and isoform 2 seem to be present in fetal and adult liver and hepG2 cells.The observed molecular weight of 65-70 kDa is the posphorylation of NR5A2 protein.

Protocols

Product Specific Protocols
WB protocol for NR5A2 antibody 22460-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Aging (Albany NY)

NR5A2 as a potential target for exercise to improve metabolic syndrome

Authors - Lingxiu Meng
mouse,humanWB,IHC,IF

Cell Prolif

LRH-1 activation alleviates diabetes-induced podocyte injury by promoting GLS2-mediated glutaminolysis

Authors - Jijia Hu
humanWB

Mol Ther Nucleic Acids

MicroRNA-3613-5p Promotes Lung Adenocarcinoma Cell Proliferation through a RELA and AKT/MAPK Positive Feedback Loop.

Authors - Tao He
  • KD Validated
mouseWB

Pharmacol Res

Geniposide reduces cholesterol accumulation and increases its excretion by regulating the FXR-mediated liver-gut crosstalk of bile acids.

Authors - Jinxin Liu
WB

J Virol

Dengue virus NS1 leads to downregulation of HNF4 alpha in liver cells resulting in a decrease in coagulation factors I, V, X, and XIII, contributing to coagulopathy

Authors - Sandeepan Das
humanWB,IHC

Front Oncol

NR5A2 Is One of 12 Transcription Factors Predicting Prognosis in HNSCC and Regulates Cancer Cell Proliferation in a p53-Dependent Manner.

Authors - Kun Zhang
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...