NR5A2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NR5A2 Polyclonal antibody (22460-1-AP)

• Featured Product
• KD/KO Validated

NR5A2 Polyclonal Antibody for WB, ELISA

Cat No. 22460-1-AP Copied!

Publications (13)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

Alpha-1-fetoprotein transcription factor, B1 binding factor, B1-binding factor, B1F, B1F2

• 

  WB analysis using 22460-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22460-1-AP (NR5A2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse ovary using 22460-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 22460-1-AP (NR5A2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat testis using 22460-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 22460-1-AP (NR5A2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NR5A2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, rat testis tissue, mouse ovary tissue, BxPC-3 cells, mouse liver tissue, mouse pancreas tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22460-1-AP targets NR5A2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, sheep
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18001

  Product name: Recombinant human NR5A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 143-332 aa of BC118652

  Sequence: NGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLL

• Full Name: nuclear receptor subfamily 5, group A, member 2
• Calculated Molecular Weight: 541 aa, 61 kDa
• Observed Molecular Weight: 61-67 kDa
• GenBank Accession Number: BC118652
• Gene Symbol: NR5A2
• Gene ID (NCBI): 2494
• RRID: AB_2879108
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: O00482
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NR5A2 belongs to the nuclear hormone receptor family NR5 subfamily.It binds to the sequence element 5'-AACGACCGACCTTGAG-3' of the enhancer II of hepatitis B virus genes, a critical cis-element of their expression and regulation.NR5A2 may be responsible for the liver-specific activity of enhancer II, probably in combination with other hepatocyte transcription factors. Key regulator of cholesterol 7-alpha-hydroxylase gene (CYP7A) expression in liver. It may also contribute to the regulation of pancreas-specific genes and play important roles in embryonic development. LRH-1 is phosphorylated to display its normal function, including its role in the intriguing potential responses to phospholipid or other ligands. The hinge domain serine residues at 238 and 243 are required for effective phosphorylation, both in vitro and in cells (16439367).NR5A1 is abundantly expressed in pancreas, less in liver, very low levels in heart and lung. Expressed in hepG2. Isoform 1 and isoform 2 seem to be present in fetal and adult liver and hepG2 cells.The observed molecular weight of 65-70 kDa is the posphorylation of NR5A2 protein.

Publications

What published studies show

NR5A2 (LRH-1) Antibody, Cat# 22460-1-AP, has 13 citations spanning journals including Cell Metabolism, JCI, Pharmacological Research, Cell Death & Discovery, Cell Proliferation, Journal of Biological Chemistry, Journal of Virology, Frontiers in Oncology, Renal Failure, Aging, Molecular Therapy Nucleic Acids, BBA Molecular Basis of Disease, and Animal Reproduction Science. Research fields cover bile acid metabolism, metabolic syndrome, pancreatic/lung/breast/prostate cancer, renal fibrosis, diabetes-induced podocyte injury, coagulopathy, and reproductive biology.

Automatically generated from the 13 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IP	Cell Metab; Hepatic FXR-FGF4 is required for bile acid homeostasis via an FGFR4-LRH-1 signal node under cholestatic stress; Authors - Lintao Song
human	WB,IHC	J Clin Invest; HSD3B1 links ileal steroid metabolism to bile acid regulation in patients with prostate cancer.; Authors - Nikou Fotouhi
mouse	WB	Pharmacol Res; Geniposide reduces cholesterol accumulation and increases its excretion by regulating the FXR-mediated liver-gut crosstalk of bile acids.; Authors - Jinxin Liu
mouse	WB	Aging (Albany NY); NR5A2 as a potential target for exercise to improve metabolic syndrome; Authors - Lingxiu Meng
human	WB,IHC	Cell Death Discov; NR5A2 transcriptional activation by BRD4 promotes pancreatic cancer progression by upregulating GDF15.; Authors - Feng Guo
mouse,human	WB,IHC,IF	Cell Prolif; LRH-1 activation alleviates diabetes-induced podocyte injury by promoting GLS2-mediated glutaminolysis; Authors - Jijia Hu