Tested Applications
| Positive WB detected in | IFN alpha treated HeLa cells, mouse brain tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human pancreas cancer tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14955-1-AP targets OAS1/3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, canine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6793 Product name: Recombinant human OAS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC000562 Sequence: MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGSYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPA Predict reactive species |
| Full Name | 2',5'-oligoadenylate synthetase 1, 40/46kDa |
| Calculated Molecular Weight | 46 kDa |
| Observed Molecular Weight | ~40 kDa, 100-120 kDa |
| GenBank Accession Number | BC000562 |
| Gene Symbol | OAS1 |
| Gene ID (NCBI) | 4938 |
| RRID | AB_2158292 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P00973 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The 2-prime,5-prime oligoadenylate synthetases (OASs), such as OAS1, are interferon-induced proteins characterized by their capacity to catalyze the synthesis of 2-prime,5-prime oligomers of adenosine (2-5As). OAS1 (type I enzymes) has some isoforms with the MW of 40, 42, 44, 46, and 48 kDa (PMID:12590567, 19383565). OAS1 is a strong candidate for determining susceptibility or resistance to viral infections(PMID:15732009). This antibody may have cross-reaction with OAS3 protein due to the high homology.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for OAS1/3 antibody 14955-1-AP | Download protocol |
| IHC protocol for OAS1/3 antibody 14955-1-AP | Download protocol |
| IP protocol for OAS1/3 antibody 14955-1-AP | Download protocol |
| WB protocol for OAS1/3 antibody 14955-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The OAS1/3 Polyclonal antibody (Cat# 14955-1-AP) has 49 citations across journals including Science, Immunity, Nature Cell Biology, Molecular Cell, Developmental Cell, Cell Reports, FASEB Journal, eLife, and Journal of Virology. Research fields span innate immunity, antiviral signaling (SARS-CoV-2, HIV, influenza, Zika, hepatitis C), interferon/JAK-STAT pathways, cancer biology (lung, breast, gastric, ovarian, glioblastoma), diabetes, and inflammatory diseases. Applications are predominantly Western blot, with some IHC, IF, and Co-IP.
| Species | Application | Title |
|---|---|---|
Immunity Flavin adenine dinucleotide is an endogenous suppressor for cytosolic DNA and RNA sensors to modulate innate immunity. | ||
Immunity OAS cross-activates RNase L intercellularly through cell-to-cell transfer of 2-5A to spread innate immunity | ||
Nat Cell Biol Redox regulation of m6A methyltransferase METTL3 in β-cells controls the innate immune response in type 1 diabetes | ||
Autophagy USP19 (ubiquitin specific peptidase 19) promotes TBK1 (TANK-binding kinase 1) degradation via chaperone-mediated autophagy. | ||
Reviews
What customers say
The single review rates the antibody 4 out of 5 stars. It was used for Western Blot at a 1:1,500 dilution on human ARPE-19 cells. The reviewer reported that the antibody performed well on interferon-gamma-induced cells, producing a detectable band, but the signal was notably weak in uninduced cells. Overall, the reviewer found the product functional for its intended application, with the main caveat being reduced sensitivity under low-expression conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Seong (Verified Customer) (11-27-2018) | OAS1 polyclonal antibody (14955-1-AP) did work by Western Blot (1:1,500) of ARPE-19 cells induced with interferon gamma but the band was very weak in uninduced cells.
|
