OS9 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• OS9 Polyclonal antibody (10061-1-AP)

• Featured Product
• KD/KO Validated

OS9 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10061-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Amplified in osteosarcoma 9, Protein OS-9

• 

  WB analysis of HEK-293 using 10061-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10061-1-AP (OS9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 10061-1-AP

  WB result of OS9 antibody (10061-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-OS9 transfected MCF-7 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10061-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10061-1-AP (OS9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10061-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10061-1-AP (OS9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10061-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10061-1-AP (OS9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 10061-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10061-1-AP (OS9 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 10061-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10061-1-AP (OS9 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 10061-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using OS9 antibody (10061-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for OS9 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, MCF-7 cells
• Positive IHC detected in: human lung cancer tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10061-1-AP targets OS9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0106

  Product name: Recombinant human OS9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 125-435 aa of BC000532

  Sequence: GRHIQQYHMEDSEIKGEVLYLGYYQSAFDWDDETAKASKQHRLKRYHSQTYGNGSKCDLNGRPREAEVRFLCDEGAGISGDYIDRVDEPLSCSYVLTIRTPRLCPHPLLRPPPSAAPQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGASPTKDDSKDSDFWKMLNEPEDQAPGGEEVPAEEQDPSPEAADSASGAPNDFQNNVQVKVIRSPADLIRFIEELKGGTKKGKPNIGQEQPVDDAAEVPQREPEKERGDPERQREMEEEEDEDEDEDEDEDERQLLGE

• Full Name: osteosarcoma amplified 9, endoplasmic reticulum associated protein
• Calculated Molecular Weight: 76 kDa
• Observed Molecular Weight: 73 kDa
• GenBank Accession Number: BC000532
• Gene Symbol: OS9
• Gene ID (NCBI): 10956
• RRID: AB_2236537
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13438
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OS-9 is a ubiquitously expressed ensoplasmic reticulum (ER)-associated protein originally identified as being amplified in certain osteosarcomas. It functions in ER quality control and ER-associated degradation (ERAD). There are three isoforms of this protein: OS-9.1, OS-9.2 and OS-9.3. The longest isoform, OS-9.1, contains 667 aa, OS-9.2 lacks aa 535-589, whereas OS-9.3 lacks aa 456-470 and 535-589. OS-9.1 and OS-9.2 are N-glycosylated, ubiquitously expressed in human tissues, and amplified in tumors. Isoform 2 is the major isoform detected in all cell types examined. This antibody can recognize all three isoforms of OS-9.

Publications

What published studies show

The OS9 Polyclonal antibody (catalog number 10061-1-AP) has 10 total citations. These appear in journals including Nature Cell Biology, Science Advances, Cell Death & Disease, Cell Biosciences, Molecular & Cellular Proteomics, FEBS Journal, and the Journal of Biological Chemistry. The associated research fields center on endoplasmic reticulum-associated degradation (ERAD), glycoprotein quality control, ubiquitin ligase complexes (Hrd1-SEL1L), N-glycosylation, and related topics such as obesity, cancer immunology, and ion channel regulation.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cell Biol; OS-9 and GRP94 deliver mutant alpha1-antitrypsin to the Hrd1-SEL1L ubiquitin ligase complex for ERAD.; Authors - Christianson John C JC ; KD Validated
Mouse	WB	Sci Adv; Adult-onset obesity is triggered by impaired mitochondrial gene expression.; Authors - Kara L Perks
human	WB	Cell Death Dis; Targeting EGFR-binding protein SLC7A11 enhancing antitumor immunity of T cells via inducing MHC-I antigen presentation in nasopharyngeal carcinoma; Authors - Haihua Wang
human	WB	Cell Biosci; Proteomic characterization of endogenous substrates of mammalian ubiquitin ligase Hrd1.; Authors - Yilin Ye
human	WB	Mol Cell Proteomics; Chemical glycoproteomic profiling in rice seedlings reveals N-glycosylation in the ERAD-L machinery; Authors - Cong Lei
human	WB	FEBS J; Endoplasmic reticulum lectin XTP3-B inhibits endoplasmic reticulum-associated degradation of a misfolded α1-antitrypsin variant.; Authors - Fujimori Tsutomu T ; KD Validated