P2RX7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• P2RX7 Polyclonal antibody (11144-1-AP)

P2RX7 Polyclonal Antibody for WB, FC (Intra), ELISA

Cat No. 11144-1-AP Copied!

Publications (30)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), ELISA

Synonyms

P2X7, Purinergic receptor

• 

  WB analysis using 11144-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11144-1-AP (P2RX7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of RAW 264.7 using 11144-1-AP

  1x10^6 RAW 264.7 cells were intracellularly stained with 0.5 ug P2RX7 Polyclonal antibody (11144-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.5 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for P2RX7 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse cerebellum tissue
• Positive FC (Intra) detected in: RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11144-1-AP targets P2RX7 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1600

  Product name: Recombinant human P2RX7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 246-595 aa of BC011913

  Sequence: AIQGGIMGIEIYWDCNLDRWFHHCHPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY

• Full Name: purinergic receptor P2X, ligand-gated ion channel, 7
• Calculated Molecular Weight: 69 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: BC011913
• Gene Symbol: P2RX7
• Gene ID (NCBI): 5027
• RRID: AB_2158371
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99572
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nucleotides, the structural subunits of the nucleic acids, are also important extracellular signaling molecules. P2 receptors are a family of cell surface receptors that mediate a wide variety of physiologic effects in response to extracellular nucleotides. These receptors fall into two classes: P2X receptors, which are ligand-gated ion channels that mediate calcium and potassium fluxes in response to ATP, and P2Y receptors, which are G protein-coupled receptors (GPCRs) (PMID: 21724990). P2RX7 functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. P2RX7 is highly expressed by cells of the haemopoietic lineage and can mediate cell death, killing of infectious organisms, and regulation of the inflammatory response (PMID: 22102807).

Publications

What published studies show

The P2X7 Receptor antibody (Cat# 11144-1-AP) has 30 total citations published across 25 journals, including Basic Research in Cardiology, International Immunopharmacology, Purinergic Signaling, Environmental Toxicology, and Journal of Experimental & Clinical Cancer Research. Research fields span oncology, cardiology, neurology, pulmonology, immunology, toxicology, hepatology, nephrology, and stem cell biology, with applications primarily in WB, IF, and IHC.

Automatically generated from the 30 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	J Exp Clin Cancer Res; Shock wave-induced ATP release from osteosarcoma U2OS cells promotes cellular uptake and cytotoxicity of methotrexate.; Authors - Baochang Qi
mouse,rat	WB,IF	Basic Res Cardiol; Renal denervation attenuates cardiac dysfunction in HFpEF by inhibiting the ATP-P2X7-NLRP3 inflammasome axis.; Authors - Zhuqing Li ; KD Validated
mouse	WB	Life Sci; Trichostatin A inhibits skeletal muscle atrophy induced by cigarette smoke exposure in mice.; Authors - Jingjing Ding
mouse	WB,IF	Int Immunopharmacol; CGRP alleviates epilepsy via JAK1-STAT1-P2RX7 signaling: a novel neuroprotective axis targeting neuronal damage.; Authors - Yuxiang Li
mouse	WB	Am J Physiol Cell Physiol; Regulatory function of praja ring finger ubiquitin ligase 2 mediated by the P2rx3/P2rx7 axis in mouse hippocampal neuronal cells.; Authors - Mengting Gong
rat	WB,IF	J Enzyme Inhib Med Chem; Radioiodinated compound FJR01: a novel P2X7R-targeted SPECT tracer for visualizing glioma-associated microglia/macrophages in a rat glioblastoma model.; Authors - Xiyan Rui