• Featured Product
  • KD/KO Validated

PARP9 Polyclonal antibody

PARP9 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 17535-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA

ADP-ribosyltransferase diphtheria toxin-like 9, ARTD9, BAL, BAL1, EC:2.4.2.-

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRaji cells, THP-1 cells
Positive IP detected inMCF-7 cells
Positive IHC detected inmouse brain tissue, human heart tissue, human kidney tissue, human lung tissue, human lymphoma tissue, human ovary tissue, human skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17535-1-AP targets PARP9 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman, treeshrew
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11587

Product name: Recombinant human PARP9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 476-819 aa of BC039580

Sequence: EARSPAINLMGFNVEEMYEAHAWIQRILSLQNHHIIENNHILYLGRKEHDILSQLQKTSSVSITEIISPGRTELEIEGARADLIEVVMNIEDMLCKVQEEMARKKERGLWRSLGQWTIQQQKTQDEMKENIIFLKCPVPPTQELLDQKKQFEKCGLQVLKVEKIDNEVLMAAFQRKKKMMEEKLHRQPVSHRLFQQVPYQFCNVVCRVGFQRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAADKLIYVFEAEVLTGFFCQGHPLNIVPPPLSPGAIDGHDSVVDNVSSPETFVIFSGMQAIPQYLWTCTQEYVQSQDYSSGPMRPFAQHPWRGFASGSPVD

Predict reactive species
Full Name poly (ADP-ribose) polymerase family, member 9
Calculated Molecular Weight 819 aa, 92 kDa
Observed Molecular Weight 88 kDa
GenBank Accession NumberBC039580
Gene Symbol PARP9
Gene ID (NCBI) 83666
RRIDAB_2158929
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8IXQ6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Poly(ADP-ribosyl)ation is a post-translational modification of proteins mediated by one of the 17 members of the poly(ADP-ribose) polymerases (PARP). PARP-9 belongs to the subfamily of macroPARPs, associating one to three macro domains to the PARP domain. Overexpression of PARP-9 stimulates cell migration in vitro, suggesting a role for PARP-9 in the promotion of malignant B cell migration and dissemination in high risk DLBCL. PARP-9 is also likely a transcription coactivator, its overexpression in B lymphocytes, stimulated by IFNγ, inducing the transcription of IFNγ-controlled genes.

Protocols

Product Specific Protocols
WB protocol for PARP9 antibody 17535-1-APDownload protocol
IHC protocol for PARP9 antibody 17535-1-APDownload protocol
IP protocol for PARP9 antibody 17535-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF

Mol Cell

Ubiquitin Modification by the E3 Ligase/ADP-Ribosyltransferase Dtx3L/Parp9.

Authors - Chun-Song Yang
humanWB

Mol Ther

PMID: 29456019

Authors - Xinyi Wang
treeshrewWB,IF

J Immunol

An Alternative Splicing of Tupaia STING Modulated Anti-RNA Virus Responses by Targeting MDA5-LGP2 and IRF3.

Authors - Ling Xu
  • KD Validated

J Biol Chem

Patient-derived organotypic tissue cultures as a platform to evaluate metabolic reprogramming in breast cancer patients

Authors - Teresa W -M Fan
humanWB

Oncol Lett

PARP9 is overexpressed in human breast cancer and promotes cancer cell migration.

Authors - Xinghong Tang
  • KD Validated
humanWB

J Mol Biol

KH-like domains in PARP9/DTX3L and PARP14 coordinate protein-protein interactions to promote cancer cell survival

Authors - Hadil Saleh
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Lisa (Verified Customer) (07-23-2025)

Good working antibody for WB.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:800
  • Cell Tissue Type: HEK293, U2OS
FH

Hadil (Verified Customer) (05-25-2023)

I have had trouble detecting PARP9 signals with other PARP9 antibodies, however, this antibody is a game changer. It works well both at room temperature (1.5 -2 hrs) and also overnight at 1:500 dilution. Would highly recommend to anyone who's studying PARP9.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mammalian cell lines (including HeLa, HNSCC cells, HEK)
Loading...
||
New chat Able
正在加载,请稍候...