Tested Applications
| Positive WB detected in | A549 cells, A431 cells, HeLa cells, HEK-293 cells, PC-3 cells, human saliva, mouse heart tissue, mouse lung tissue, rat brain tissue, U-937 cells, THP-1 cells, RAW 264.7 cells |
| Positive IHC detected in | human pancreas cancer tissue, human kidney tissue, human lung cancer tissue, human ovary tumor tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 10 publications below |
| IHC | See 8 publications below |
| IF | See 2 publications below |
Product Information
18410-1-AP targets Progranulin/PGRN in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13178 Product name: Recombinant human PCDGF,GRN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-363 aa of BC000324 Sequence: MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRD Predict reactive species |
| Full Name | granulin |
| Calculated Molecular Weight | 64 kDa |
| Observed Molecular Weight | 60-70 kDa |
| GenBank Accession Number | BC000324 |
| Gene Symbol | Granulin |
| Gene ID (NCBI) | 2896 |
| RRID | AB_10598161 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P28799 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GRN, also known as PGRN or PCDGF, is a cysteine-rich protein of 68.5 kDa that is typically secreted into a highly glycosylated 88 kDa form. PGRN is a unique growth factor that plays an important role in cutaneous wound healing. It has an anti-inflammatory effect and promotes cell proliferation. When PCDGF is degraded to several 6-25 kDa fragments, called granulins (GRNs) by neutrophil proteases, a pro-inflammatory reaction occurs. PGRN is widely expressed, particularly in epithelial cells, immune cells, neurons, and chondrocytes. High levels of PGRN expression have been reported in human cancers, and its expression is closely correlated with the development and metastasis of several cancers. The recent discovery that mutations in the gene encoding for pro-granulin (GRN) cause frontotemporal lobar degeneration (FTLD), and other neurodegenerative diseases leading to dementia, has brought renewed interest in progranulin and its functions in the central nervous system.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Progranulin/PGRN antibody 18410-1-AP | Download protocol |
| WB protocol for Progranulin/PGRN antibody 18410-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Phytomedicine Rg3 inhibits hypoxia-induced tumor exosomes from boosting pancreatic cancer vasculogenic mimicry through the HIF-1α/LARS1/mTOR axis | ||
Transl Psychiatry Progranulin improves neural development via the PI3K/Akt/GSK-3β pathway in the cerebellum of a VPA-induced rat model of ASD. | ||
J Proteome Res Mining the gastric cancer secretome: identification of GRN as a potential diagnostic marker for early gastric cancer. | ||
J Mol Med (Berl) Progranulin alleviates podocyte injury via regulating CAMKK/AMPK-mediated autophagy under diabetic conditions. | ||
Front Oncol GRN is a prognostic biomarker and correlated with immune infiltration in glioma: A study based on TCGA data | ||
Neuropharmacology Abnormal spatiotemporal expression pattern of progranulin and neurodevelopment impairment in VPA-induced ASD rat model. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Sharan (Verified Customer) (06-24-2020) | The antibody detects the GRN protein but there is also a lot of cross-reactivity with non-specific antigens in HeLa lysate
![]() |










































