PCNA Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PCNA Polyclonal antibody (24036-1-AP)

PCNA Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 24036-1-AP Copied!

Publications (43)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF-P, IP, RIP, ELISA

Synonyms

Cyclin, proliferating cell nuclear antigen

• 

  WB analysis of HEK-293 using 24036-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 24036-1-AP (PCNA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 24036-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24036-1-AP (PCNA antibody) at dilution of 1:7000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 24036-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 24036-1-AP (PCNA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 24036-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 24036-1-AP (PCNA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 24036-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 24036-1-AP (PCNA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Raji using 24036-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 24036-1-AP (PCNA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 24036-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 24036-1-AP (PCNA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat liver using 24036-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 24036-1-AP (PCNA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 24036-1-AP

  IP result of anti-PCNA (IP:24036-1-AP, 4ug; Detection:24036-1-AP 1:1000) with HEK-293 cells lysate 2000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 24036-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 24036-1-AP (PCNA antibody) at dilution of 1:1600 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 24036-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24036-1-AP (PCNA Antibody) at dilution of 1:400 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 24036-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 24036-1-AP (PCNA antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 24036-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24036-1-AP (PCNA Antibody) at dilution of 1:400 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 24036-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 24036-1-AP (PCNA Antibody) at dilution of 1:400 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 24036-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 24036-1-AP (PCNA Antibody) at dilution of 1:400 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 24036-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 24036-1-AP (PCNA antibody) at dilution of 1:1600 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human breast cancer using 24036-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using 24036-1-AP (PCNA antibody), at dilution of 1:100 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human breast cancer using 24036-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using 24036-1-AP (PCNA antibody), at dilution of 1:100 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PCNA in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse testis tissue, Raji cells, HEK-293 cells, NIH/3T3 cells, MCF-7 cells, rat liver tissue, HepG2 cells, Jurkat cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human breast cancer tissue, human gliomas tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human breast cancer tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:14000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24036-1-AP targets PCNA in WB, IHC, IF-P, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, rabbit, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7416

  Product name: Recombinant human PCNA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 8-256 aa of BC000491

  Sequence: QGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIE

• Full Name: proliferating cell nuclear antigen
• Calculated Molecular Weight: 29 kDa/31 kDa
• Observed Molecular Weight: 36-38 kDa
• GenBank Accession Number: BC000491
• Gene Symbol: PCNA
• Gene ID (NCBI): 5111
• RRID: AB_2879414
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P12004
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The proliferating cell nuclear antigen (PCNA), a protein synthesized in early G1 and S phases of the cell cycle, functions in cell cycle progression, DNA replication and DNA repair. In early S phase, PCNA exhibits granular distribution and is absent from the nucleoli; however, in late S phase, it relocates to the nucleoli. PCNA exists in two basic forms: one involved in ongoing DNA replication, which localizes specifically to the nucleus, and a second, soluble form, not implicated in constant synthesis. Interestingly, the latter form degrades in the presence of organic solvents, rendering it undetectable by histological methods in tissues using organic fixatives, and thus also providing a method of visualizing only the synthesizing form.This antibody specifically react with the 36kd human PCNA protein.

Publications

What published studies show

The PCNA Polyclonal antibody (Cat# 24036-1-AP) has 43 citations across journals including Int J Biol Sci, Cell Death & Discovery, Br J Pharmacol, Biochem Pharmacol, JCI Insight, Front Pharmacol, BMC Cancer, and PLoS ONE. Research fields span oncology (hepatocellular, ovarian, breast, esophageal cancers), pulmonary hypertension, bone biology, reproductive physiology, neurodevelopment, and cell cycle regulation.

Automatically generated from the 43 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Int J Biol Sci; Tendon Cells Root Into (Instead of Attach to) Humeral Bone Head via Fibrocartilage-Enthesis; Authors - Zheng Wang
rat	IF	Cell Death Discov; Zona pellucida is required for oocyte actin cortex and oocyte-somatic cell interactions during oocyte growth.; Authors - Shoujing Liang
human,mouse	WB	Int J Surg; Selenomethionine alleviates aortic dissection via PGC-1α/NRF2/TFAM-mediated mitochondrial biosynthesis against ferroptosis: an experimental study.; Authors - Shengwei Lai
mouse	IHC	Int J Biol Macromol; YTHDF2 promotes arsenic carcinogenesis through m(6)A-dependent SMAD7 decay and PRR5 escape from decay.; Authors - Qian Zhang
human,mouse	WB	Phytother Res; Phenethyl Isothiocyanate Suppresses Hepatocellular Carcinoma Progression and Immune Evasion via ZNF652 Regulation of PD-L1.; Authors - Dongxue Ren
		Br J Pharmacol; Squalene epoxidase promotes hepatocellular carcinoma development by activating STRAP transcription and TGF-β/SMAD signaling; Authors - Zhirui Zhang