CCM3/PDCD10 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CCM3/PDCD10 Polyclonal antibody (10294-2-AP)

• Featured Product
• KD/KO Validated

CCM3/PDCD10 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 10294-2-AP Copied!

Publications (22)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

CCM3, CCM3/PDCD10, PDCD10, programmed cell death 10, TFAR15

• 

  WB analysis using 10294-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10294-2-AP (CCM3/PDCD10 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of MCF-7 using 10294-2-AP

  IP result of anti-CCM3/PDCD10 (IP:10294-2-AP, 4ug; Detection:10294-2-AP 1:500) with MCF-7 cells lysate 2120 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10294-2-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10294-2-AP (CCM3/PDCD10 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10294-2-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10294-2-AP (CCM3/PDCD10 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CCM3/PDCD10 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells, PC-3 cells, Raji cells
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10294-2-AP targets CCM3/PDCD10 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0348

  Product name: Recombinant human PDCD10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 9-101 aa of BC002506

  Sequence: KNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQ

• Full Name: programmed cell death 10
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC002506
• Gene Symbol: PDCD10
• Gene ID (NCBI): 11235
• RRID: AB_2162153
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BUL8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDCD10, also named CCM3 and TFAR15, belongs to the PDCD10 family. PDCD10 promotes cell proliferation, increases MAPK activity and modulates apoptotic pathways. PDCD10 is important for cell migration and for normal structure and assembly of the Golgi complex. PDCD10 is required for normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development, moreover, defects in PDCD10 showed abnormal cardiovascular development. Catalog#10294-2-AP is a rabbit polyclonal antibody raised against the full-length PDCD10 of human origin.

Publications

What published studies show

CCM3/PDCD10 Polyclonal antibody (Cat# 10294-2-AP) has 22 citations in journals including Nature Cell Biology, Journal of Clinical Investigation, Cell Reports, Journal of Biological Chemistry, Development, FASEB Journal, Cell Death & Disease, and others. Research fields span cerebral cavernous malformations, cancer (hepatocellular, renal cell, pituitary, pancreatic, esophageal), cell signaling (YAP/TAZ, NF-κB, AKT/ERK), neuronal development, vesicle trafficking, mechanotransduction, angiogenesis, and Golgi assembly.

Automatically generated from the 22 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Cell Biol; CCM3 is a gatekeeper in focal adhesions regulating mechanotransduction and YAP/TAZ signalling.; Authors - Shan Wang ; KO Validated
		J Extracell Vesicles; Programmed Cell Death Protein 10 (PDCD10) Regulates Vesicle Trafficking and Contributes to the Progression of Clear Cell Renal Cell Carcinoma; Authors - Rui Wang
human,mouse	WB,IHC	J Clin Invest; Mutations in 2 distinct genetic pathways result in cerebral cavernous malformations in mice.; Authors - Chan Aubrey C AC ; KD Validated
human	WB,IHC,IF,IP	Cell Death Dis; Programmed cell death 10 promotes metastasis and epithelial-mesenchymal transition of hepatocellular carcinoma via PP2Ac-mediated YAP activation.; Authors - Bo Sun ; KD Validated
rat	WB	Cell Rep; The STRIPAK complex is required for radial sorting and laminin receptor expression in Schwann cells; Authors - Michael R Weaver
human	WB	Cell Rep; Proteomic analysis reveals a PLK1-dependent G2/M degradation program and a role for AKAP2 in coordinating the mitotic cytoskeleton; Authors - Ryan D Mouery