Tested Applications
| Positive WB detected in | MCF-7 cells, PC-3 cells, Raji cells |
| Positive IP detected in | MCF-7 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10294-2-AP targets CCM3/PDCD10 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0348 Product name: Recombinant human PDCD10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 9-101 aa of BC002506 Sequence: KNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQ Predict reactive species |
| Full Name | programmed cell death 10 |
| Calculated Molecular Weight | 25 kDa |
| Observed Molecular Weight | 25-30 kDa |
| GenBank Accession Number | BC002506 |
| Gene Symbol | PDCD10 |
| Gene ID (NCBI) | 11235 |
| RRID | AB_2162153 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BUL8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PDCD10, also named CCM3 and TFAR15, belongs to the PDCD10 family. PDCD10 promotes cell proliferation, increases MAPK activity and modulates apoptotic pathways. PDCD10 is important for cell migration and for normal structure and assembly of the Golgi complex. PDCD10 is required for normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development, moreover, defects in PDCD10 showed abnormal cardiovascular development. Catalog#10294-2-AP is a rabbit polyclonal antibody raised against the full-length PDCD10 of human origin.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CCM3/PDCD10 antibody 10294-2-AP | Download protocol |
| IP protocol for CCM3/PDCD10 antibody 10294-2-AP | Download protocol |
| WB protocol for CCM3/PDCD10 antibody 10294-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
CCM3/PDCD10 Polyclonal antibody (Cat# 10294-2-AP) has 22 citations in journals including Nature Cell Biology, Journal of Clinical Investigation, Cell Reports, Journal of Biological Chemistry, Development, FASEB Journal, Cell Death & Disease, and others. Research fields span cerebral cavernous malformations, cancer (hepatocellular, renal cell, pituitary, pancreatic, esophageal), cell signaling (YAP/TAZ, NF-κB, AKT/ERK), neuronal development, vesicle trafficking, mechanotransduction, angiogenesis, and Golgi assembly.
| Species | Application | Title |
|---|---|---|
Nat Cell Biol CCM3 is a gatekeeper in focal adhesions regulating mechanotransduction and YAP/TAZ signalling.
| ||
J Extracell Vesicles Programmed Cell Death Protein 10 (PDCD10) Regulates Vesicle Trafficking and Contributes to the Progression of Clear Cell Renal Cell Carcinoma | ||
J Clin Invest Mutations in 2 distinct genetic pathways result in cerebral cavernous malformations in mice.
| ||
Cell Death Dis Programmed cell death 10 promotes metastasis and epithelial-mesenchymal transition of hepatocellular carcinoma via PP2Ac-mediated YAP activation.
| ||
Cell Rep The STRIPAK complex is required for radial sorting and laminin receptor expression in Schwann cells | ||
Cell Rep Proteomic analysis reveals a PLK1-dependent G2/M degradation program and a role for AKAP2 in coordinating the mitotic cytoskeleton |







