VPS34 (C terminal) Polyclonal antibody

• 

  WB analysis of PC-3 using 12452-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 12452-1-AP

  WB result of VPS34 (C terminal) antibody (12452-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-VPS34 (C terminal) transfected Jurkat cells.

• 

  WB analysis of rat brain using 12452-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 12452-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12452-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 12452-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 12452-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12452-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 12452-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12452-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 12452-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 12452-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 12452-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12452-1-AP (VPS34 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 12452-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12452-1-AP (VPS34 antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human heart using 12452-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 12452-1-AP (VPS34 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human heart using 12452-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 12452-1-AP (VPS34 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of PC-3 using 12452-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using VPS34 (C terminal) antibody (12452-1-AP) at dilution of 1:600 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

VPS34 (C terminal) Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12452-1-AP

Publications(65)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

PIK3C3, Vps34, EC:2.7.1.137, hVps34, PI 3 Kinase Class 3

---

Tested Applications

• Positive WB detected in: PC-3 cells, mouse brain tissue, HeLa cells, human testis tissue, human brain tissue, mouse lung tissue, mouse testis tissue, Jurkat cells, rat brain tissue
• Positive IHC detected in: human prostate cancer tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 62 publications below
• IF: See 5 publications below
• IP: See 2 publications below
• CoIP: See 1 publications below

Product Information

12452-1-AP targets VPS34 (C terminal) in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3110

  Product name: Recombinant human PIK3C3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 600-887 aa of BC033004

  Sequence: KIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK

• Full Name: phosphoinositide-3-kinase, class 3
• Calculated Molecular Weight: 887 aa, 100 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC033004
• Gene Symbol: VPS34
• Gene ID (NCBI): 5289
• RRID: AB_2299709
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NEB9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PIK3C3(Phosphatidylinositol 3-kinase catalytic subunit type 3) is also named as VPS34 and belongs to the PI3/PI4-kinase family.It is a catalytic subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate which plays a key role in initiation and maturation of autophagosomes.It can form a dimer(PMID:20339072).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cancer; Overcoming multi-drug resistance in SCLC: a synergistic approach with venetoclax and hydroxychloroquine targeting the lncRNA LYPLAL1-DT/BCL2/BECN1 pathway; Authors - Shuxin Li
mouse	WB,IF	J Thromb Haemost; Vps34 derived phosphatidylinositol 3-monophosphate modulates megakaryocyte maturation and proplatelet production through late endosomes/lysosomes.; Authors - Ivana Bertović
human	WB	Mol Cancer; PMID: 32727463; Authors - Cefan Zhou
human	WB	Nat Commun; Endonuclease G promotes autophagy by suppressing mTOR signaling and activating the DNA damage response.; Authors - Wenjun Wang
human	WB	Nat Commun; Structural basis for VPS34 kinase activation by Rab1 and Rab5 on membranes.; Authors - Shirley Tremel
	IP,CoIP	Nat Commun; IL-6 regulates autophagy and chemotherapy resistance by promoting BECN1 phosphorylation.; Authors - Fuqing Hu