Tested Applications
| Positive WB detected in | mouse liver tissue, 293 cell, HEK-293 cells, HeLa cells, HepG2 cells, HepG2.MCF7 cells, human kidney tissue, human liver tissue, MCF-7 cells, mouse heart tissue, mouse muscle/liver tissue, mouse skeletal muscle tissue, multi-cells/tissue, Raji cells, rat liver tissue |
| Positive IHC detected in | human lung cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22456-1-AP targets PKLR in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17933 Product name: Recombinant human PKLR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 446-556 aa of BC025737 Sequence: PLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVT Predict reactive species |
| Full Name | pyruvate kinase, liver and RBC |
| Calculated Molecular Weight | 574 aa, 62 kDa |
| Observed Molecular Weight | 58-62 kDa |
| GenBank Accession Number | BC025737 |
| Gene Symbol | PKLR |
| Gene ID (NCBI) | 5313 |
| RRID | AB_10918271 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P30613 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PKLR(Pyruvate kinase isozymes R/L) is also named as PK1,PKL,which is a glycolytic enzyme that catalyzes the transphosphorylation from phosphoenolpyruvate (PEP) to ADP, yielding pyruvate and ATP. It is the last step of the glycolytic pathway and is essentially irreversible.It belongs to the pyruvate kinase family and There are 4 isozymes of pyruvate kinase in mammals: L, R, M1 and M2. L type is major isozyme in the liver, R is found in red cells, M1 is the main form in muscle, heart and brain, and M2 is found in early fetal tissues.Defects in PKLR are the cause of pyruvate kinase hyperactivity (PKHYP) and pyruvate kinase deficiency of red cells (PKRD).It can form a homotetramer(PMID:11960989).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PKLR antibody 22456-1-AP | Download protocol |
| WB protocol for PKLR antibody 22456-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Med Pyruvate kinase M2 activation may protect against the progression of diabetic glomerular pathology and mitochondrial dysfunction. | ||
Cell Metab Multi-Tissue Acceleration of the Mitochondrial Phosphoenolpyruvate Cycle Improves Whole-Body Metabolic Health. | ||
Mol Ther Extracellular vesicle-mediated communication between hepatocytes and natural killer cells promotes hepatocellular tumorigenesis. | ||
Int J Mol Sci Loss of miR-23b/27b/24-1 Cluster Impairs Glucose Tolerance via Glycolysis Pathway in Mice. | ||
Sci Rep Up-regulation of PKM2 promote malignancy and related to adverse prognostic risk factor in human gallbladder cancer. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
ziwei (Verified Customer) (12-05-2025) | WORKS GREAT!
|



































