Tested Applications
| Positive WB detected in | mouse brain tissue, HepG2 cells |
| Positive IHC detected in | human kidney tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23795-1-AP targets Plexin B1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20719 Product name: Recombinant human PLXNB1 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 20-369 aa of BC146793 Sequence: LQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPV Predict reactive species |
| Full Name | plexin B1 |
| Calculated Molecular Weight | 2135 aa, 232 kDa |
| Observed Molecular Weight | 210 kDa |
| GenBank Accession Number | BC146793 |
| Gene Symbol | PLXNB1 |
| Gene ID (NCBI) | 5364 |
| RRID | AB_2879326 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | O43157 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Semaphorins, originally identified as axon guidance molecules, have also been implicated in angiogenesis, immunoregulation, and cancer (PMID: 16584533). Plexins are main receptors for semaphorins and are thought to control many of the functional effects of semaphorins. PLXNB1 is one of the three plexin-B family members. It is a high-affinity receptor for semaphorin 4D (SEMA4D). Interaction of SEMA4D and PLXNB1 has important physiologic effects in the immune and nervous systems, and is also involved in tumor progression, especially in tumor angiogenesis (PMID: 20858260).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Plexin B1 antibody 23795-1-AP | Download protocol |
| WB protocol for Plexin B1 antibody 23795-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Plexin B1 Polyclonal antibody (Cat# 23795-1-AP) has 7 total citations. These appear in journals including Nature Communications, Journal of Translational Medicine, Cancer Immunology Research, Cell Proliferation, Journal of Neuroendocrinology, and Annals of Translational Medicine. Research fields span spinal cord injury and axon pathfinding, acute myeloid leukemia, cancer immunotherapy, osteonecrosis, hypogonadotropic hypogonadism, preeclampsia, and intracerebral hemorrhage. Applications include WB, IF, and IHC across human, mouse, and rat species.
| Species | Application | Title |
|---|---|---|
Nat Commun Plexin-B1 safeguards astrocyte agility and glial alignment to facilitate wound corralling and axon pathfinding in mouse spinal cord injury model.
| ||
J Transl Med SEMA4D/PlexinB1 promotes AML progression via activation of PI3K/Akt signaling. | ||
Cancer Immunol Res Semaphorin4D Inhibition Improves Response to Immune-Checkpoint Blockade via Attenuation of MDSC Recruitment and Function. | ||
Cell Prolif Soluble Sema4D From γδ T Cells Exerts Osteoblast Inhibition via Plexin-B/mTOR Signalling Contributing to Pathogenesis of Bisphosphonate-Related Osteonecrosis of the Jaws.
| ||
J Neuroendocrinol PLXNB1 mutations in the etiology of idiopathic hypogonadotropic hypogonadism. | ||
Ann Transl Med Methylation-based epigenetic studies and gene integration analysis of preeclampsia |
Reviews
What customers say
The single review for this product reports a 1-star rating from a Western Blot application. The user noted that while the target's calculated molecular weight is 230 kD, the antibody recognized major bands at 35 and 30 kD instead, suggesting the expected target band was not detected. Overall, the feedback indicates the product did not perform as anticipated for the intended application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Boyan (Verified Customer) (10-04-2021) | calculated size 230 kd. this antibody recognized major bands at 35, 30 kd.
|
