Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, human skeletal muscle tissue, rat ovary tissue, SKOV-3 cells, MCF-7 cells |
| Positive IP detected in | mouse skeletal muscle tissue |
| Positive IHC detected in | human breast cancer tissue, mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
18167-1-AP targets AMPK Alpha 2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12796 Product name: Recombinant human PRKAA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 215-552 aa of BC069680 Sequence: DDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR Predict reactive species |
| Full Name | protein kinase, AMP-activated, alpha 2 catalytic subunit |
| Calculated Molecular Weight | 552 aa, 62 kDa |
| Observed Molecular Weight | 62 kDa |
| GenBank Accession Number | BC069680 |
| Gene Symbol | AMPK Alpha 2 |
| Gene ID (NCBI) | 5563 |
| RRID | AB_10695046 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P54646 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PRKAA2(protein kinase, AMP-activated, alpha 2 catalytic subunit), also named as AMPKA2, AMPK, PRKAA, AMPK2, belongs to the CAMK Ser/Thr protein kinase family and SNF1 subfamily. PRKAA2 is an αβγ heterotrimer that is activated by low cellular energy status, such as decreases in both the ATP/AMP ratio and the phosphocreatine content and it is a glycogen synthase kinase, phosphorylating Ser7 at the NH2 terminus, which decreases glycogen synthase activity (PMID:14532170). The protein can be ubiquitinated (PMID:21224036).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AMPK Alpha 2 antibody 18167-1-AP | Download protocol |
| IHC protocol for AMPK Alpha 2 antibody 18167-1-AP | Download protocol |
| IP protocol for AMPK Alpha 2 antibody 18167-1-AP | Download protocol |
| WB protocol for AMPK Alpha 2 antibody 18167-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The AMPK Alpha 2 Polyclonal antibody (Cat# 18167-1-AP) has 76 citations. Publications appear in high-impact journals including Nature, Cell Metabolism, Cancer Research, Autophagy, Nature Communications, Cell Reports, Development, and Immunity, as well as journals such as Acta Pharm Sin B, Free Radic Biol Med, and International Journal of Molecular Sciences. Research fields span lipid metabolism, diabetes, cancer (breast, liver, lung, colorectal), ferroptosis and autophagy, cardiovascular disease, neurology, osteoarthritis, and inflammation, with Western blot the dominant application.
| Species | Application | Title |
|---|---|---|
Cell Metab Elevation of JAML Promotes Diabetic Kidney Disease by Modulating Podocyte Lipid Metabolism. | ||
Cell Metab Dietary timing enhances exercise by modulating fat-muscle crosstalk via adipocyte AMPKα2 signaling | ||
Cancer Res ARID1A Stimulates Notch-TLL1 Signaling to Induce Cancer-Associated Fibroblast Activation and Intrahepatic Cholangiocarcinoma Development | ||
Drug Resist Updat AMPKα2 attenuates doxorubicin induced ferroptosis by promoting NCOA4 degradation in triple negative breast cancer. | ||
Autophagy Buddleoside alleviates nonalcoholic steatohepatitis by targeting the AMPK-TFEB signaling pathway |
Reviews
What customers say
The single review for 18167-1-AP is a 5-star rating from a Western Blot application on heart tissue at a 1:5000 dilution. The reviewer highlights the antibody's high specificity, strong and robust signal, and low background. They also note consistent, reproducible performance and good lot-to-lot consistency, indicating reliable results across experiments.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
YINGJIAN (Verified Customer) (08-15-2025) | high specificity, strong/robust signal, low background, consistent results, reproducible performance, good lot-to-lot consistency
 |
