Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, human skeletal muscle tissue, rat ovary tissue, SKOV-3 cells, MCF-7 cells |
| Positive IP detected in | mouse skeletal muscle tissue |
| Positive IHC detected in | human breast cancer tissue, mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 11 publications below |
| WB | See 57 publications below |
| IHC | See 4 publications below |
| IF | See 4 publications below |
| IP | See 3 publications below |
Product Information
18167-1-AP targets AMPK Alpha 2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12796 Product name: Recombinant human PRKAA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 215-552 aa of BC069680 Sequence: DDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR Predict reactive species |
| Full Name | protein kinase, AMP-activated, alpha 2 catalytic subunit |
| Calculated Molecular Weight | 552 aa, 62 kDa |
| Observed Molecular Weight | 62 kDa |
| GenBank Accession Number | BC069680 |
| Gene Symbol | AMPK Alpha 2 |
| Gene ID (NCBI) | 5563 |
| RRID | AB_10695046 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P54646 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PRKAA2(protein kinase, AMP-activated, alpha 2 catalytic subunit), also named as AMPKA2, AMPK, PRKAA, AMPK2, belongs to the CAMK Ser/Thr protein kinase family and SNF1 subfamily. PRKAA2 is an αβγ heterotrimer that is activated by low cellular energy status, such as decreases in both the ATP/AMP ratio and the phosphocreatine content and it is a glycogen synthase kinase, phosphorylating Ser7 at the NH2 terminus, which decreases glycogen synthase activity (PMID:14532170). The protein can be ubiquitinated (PMID:21224036).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AMPK Alpha 2 antibody 18167-1-AP | Download protocol |
| IHC protocol for AMPK Alpha 2 antibody 18167-1-AP | Download protocol |
| IP protocol for AMPK Alpha 2 antibody 18167-1-AP | Download protocol |
| WB protocol for AMPK Alpha 2 antibody 18167-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab Dietary timing enhances exercise by modulating fat-muscle crosstalk via adipocyte AMPKα2 signaling | ||
Cell Metab Elevation of JAML Promotes Diabetic Kidney Disease by Modulating Podocyte Lipid Metabolism. | ||
Autophagy Buddleoside alleviates nonalcoholic steatohepatitis by targeting the AMPK-TFEB signaling pathway | ||
Dev Cell Endothelial progenitor cells control remodeling of uterine spiral arteries for the establishment of utero-placental circulation | ||
ACS Appl Mater Interfaces Biocompatible Chitin Hydrogel Incorporated with PEDOT Nanoparticles for Peripheral Nerve Repair. | ||
Autophagy TSPAN1 promotes autophagy flux and mediates cooperation between WNT-CTNNB1 signaling and autophagy via the MIR454-FAM83A-TSPAN1 axis in pancreatic cancer. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH YINGJIAN (Verified Customer) (08-15-2025) | high specificity, strong/robust signal, low background, consistent results, reproducible performance, good lot-to-lot consistency
![]() |


























