CD133 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CD133 Polyclonal antibody (18495-1-AP)

CD133 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18495-1-AP Copied!

Publications (15)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

AC133, Antigen AC133, CORD12, MCDR2, MSTP061

• 

  WB analysis using 18495-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18495-1-AP (CD133 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 18495-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 18495-1-AP (PROM1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human intrahepatic cholangiocarcinoma using 18495-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 18495-1-AP (CD133 antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human intrahepatic cholangiocarcinoma using 18495-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 18495-1-AP (CD133 antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 18495-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 18495-1-AP (CD133 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 18495-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 18495-1-AP (CD133 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of Caco-2 using 18495-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed Caco-2 cells using CD133 antibody (18495-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD133 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Caco-2 cells, mouse skeletal muscle tissue, HT-29 cells
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Caco-2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18495-1-AP targets CD133 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13327

  Product name: Recombinant human CD133 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 505-782 aa of BC012089

  Sequence: LICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPL

• Full Name: prominin 1
• Calculated Molecular Weight: 97 kDa
• Observed Molecular Weight: 110-115 kDa
• GenBank Accession Number: BC012089
• Gene Symbol: CD133
• Gene ID (NCBI): 8842
• RRID: AB_2172858
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43490
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD133, also known as PROM1 (prominin-1) or AC133, belongs to the prominin family. CD133 is a transmembrane glycoprotein with an NH2-terminal extracellular domain, five transmembrane loops and a cytoplasmic tail. The expression of CD133 has been reported in hematopoietic stem cells, endothelial progenitor cells, neuronal and glial stem cells, suggesting the potential role of CD133 as a cell surface marker of adult stem cells. CD133 has also been reported as a marker of cancer stem cells in various human tumors.

Publications

What published studies show

The CD133 Polyclonal antibody (Cat# 18495-1-AP) has 15 citations published in journals including ACS Nano, Biomaterials, Oncogene, eLife, Cancer Med, Exp Cell Res, Front Oncol, and others. Research fields span cancer stem cell biology, glioma, pancreatic cancer, colorectal cancer, gastric cancer, melanoma, osteosarcoma, and cholangiocarcinoma, with applications in radio-immunotherapy, EMT, stemness regulation, and stroke research.

Automatically generated from the 15 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	ACS Nano; Mesenchymal Stem Cell-Derived Mitochondrial Transfer Promotes Tip Cell Phenotype via Glutathione Metabolic Reprogramming in Stroke Mice; Authors - Qiao Zhang
mouse,human	WB	Biomaterials; Radiation-triggerable bioreactors enable bioenergetic reprograming of cancer stem cell plasticity via targeted arginine metabolism disruption for augmented radio-immunotherapy; Authors - Xuemei Yao
human	WB	Oncogene; Cancer stem cells-derived exosomal TSPAN8 enhances non-stem cancer cells stemness and promotes malignant progression in PDAC; Authors - Xiaoyi Yang
mouse,human	WB,IF	J Oncol; The Role of Purine Metabolism-Related Genes PPAT and IMPDH1 in the Carcinogenesis of Intrahepatic Cholangiocarcinoma Based on Metabonomic and Bioinformatic Analyses; Authors - Chang-Jun Liu
human	IF	Biomedicines; Engineering Bone-Mimetic Microspheres to Recapitulate the Tumor Microenvironment for In Vitro Osteosarcoma Modeling.; Authors - Fangqiao Zheng
human		Exp Cell Res; Downregulation of CTRP1 Reduces Radio-resistance in Glioblastoma Cells by Inhibiting the Expression of CD133 after X-ray and Carbon Ion Irradiation; Authors - Ke Huang