PSMD2 Polyclonal antibody

• 

  WB analysis using 14748-1-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 14748-1-AP (PSMD2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14748-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14748-1-AP (PSMD2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 14748-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 14748-1-AP (PSMD2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 14748-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 14748-1-AP (PSMD2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 14748-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 14748-1-AP (PSMD2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 14748-1-AP

  IP result of anti-PSMD2 (IP:14748-1-AP, 4ug; Detection:14748-1-AP 1:1000) with K-562 cells lysate 3320ug.

• 

  IHC staining of human breast cancer using 14748-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14748-1-AP (PSMD2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 14748-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14748-1-AP (PSMD2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

PSMD2 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 14748-1-AP

Publications(16)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

26S proteasome subunit p97, P97, Protein 55.11, PSMD2, Rpn1, S2, TRAP2

---

Tested Applications

• Positive WB detected in: SKOV-3 cells, HeLa cells, K-562 cells, human heart tissue, mouse skeletal muscle tissue, PC-3 cells, A431 cells, HL-60 cells, mouse heart tissue, rat heart tissue
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 15 publications below
• IHC: See 3 publications below
• IF: See 3 publications below
• IP: See 1 publications below
• CoIP: See 3 publications below

Product Information

14748-1-AP targets PSMD2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6484

  Product name: Recombinant human PSMD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 561-908 aa of BC002368

  Sequence: GLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVILRKNPNYDL

• Full Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 2
• Calculated Molecular Weight: 100 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC002368
• Gene Symbol: PSMD2
• Gene ID (NCBI): 5708
• RRID: AB_2170472
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13200
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tumor necrosis factor type 1 receptor-associated protein 2 (TRAP2), encoded by PSMD2 gene, is a non-ATPase regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. TRAP2 may also participate in the TNF signalling pathway since it interacts with the tumor necrosis factor type 1 receptor.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell; Cancer vulnerabilities unveiled by genomic loss.; Authors - Nijhawan Deepak D
human	WB	Oncogene; The degradation of p53 and its major E3 ligase Mdm2 is differentially dependent on the proteasomal ubiquitin receptor S5a.; Authors - Sparks A A
human	WB	Cells; The Identification of Nuclear FMRP Isoform Iso6 Partners; Authors - Nassim Ledoux
human	WB,CoIP	Cell Commun Signal; NQO1 potentiates apoptosis evasion and upregulates XIAP via inhibiting proteasome-mediated degradation SIRT6 in hepatocellular carcinoma.; Authors - Hong-Zhong Zhou
pig	WB,IF	J Virol; The S273R protein of African swine fever virus antagonizes the canonical NF-κB signaling pathway by IκBα; Authors - Haojie Ren
human	WB	BMC Mol Biol; PSMD1 and PSMD2 regulate HepG2 cell proliferation and apoptosis via modulating cellular lipid droplet metabolism.; Authors - Yanjie Tan