• Featured Product
  • KD/KO Validated

PSMD2 Polyclonal antibody

PSMD2 Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 14748-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, CoIP, ELISA

26S proteasome subunit p97, P97, Protein 55.11, PSMD2, Rpn1, S2, TRAP2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSKOV-3 cells, HeLa cells, K-562 cells, human heart tissue, mouse skeletal muscle tissue, PC-3 cells, A431 cells, HL-60 cells, mouse heart tissue, rat heart tissue
Positive IP detected inK-562 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14748-1-AP targets PSMD2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6484

Product name: Recombinant human PSMD2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 561-908 aa of BC002368

Sequence: GLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVILRKNPNYDL

Predict reactive species
Full Name proteasome (prosome, macropain) 26S subunit, non-ATPase, 2
Calculated Molecular Weight 100 kDa
Observed Molecular Weight100 kDa
GenBank Accession NumberBC002368
Gene Symbol PSMD2
Gene ID (NCBI) 5708
RRIDAB_2170472
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13200
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tumor necrosis factor type 1 receptor-associated protein 2 (TRAP2), encoded by PSMD2 gene, is a non-ATPase regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. TRAP2 may also participate in the TNF signalling pathway since it interacts with the tumor necrosis factor type 1 receptor.

Protocols

Product Specific Protocols
IHC protocol for PSMD2 antibody 14748-1-APDownload protocol
IP protocol for PSMD2 antibody 14748-1-APDownload protocol
WB protocol for PSMD2 antibody 14748-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell

Cancer vulnerabilities unveiled by genomic loss.

Authors - Nijhawan Deepak D
humanWB

Oncogene

The degradation of p53 and its major E3 ligase Mdm2 is differentially dependent on the proteasomal ubiquitin receptor S5a.

Authors - Sparks A A
humanWB

Cells

The Identification of Nuclear FMRP Isoform Iso6 Partners

Authors - Nassim Ledoux
humanWB,CoIP

Cell Commun Signal

NQO1 potentiates apoptosis evasion and upregulates XIAP via inhibiting proteasome-mediated degradation SIRT6 in hepatocellular carcinoma.

Authors - Hong-Zhong Zhou
pigWB,IF

J Virol

The S273R protein of African swine fever virus antagonizes the canonical NF-κB signaling pathway by IκBα

Authors - Haojie Ren
humanWB

BMC Mol Biol

PSMD1 and PSMD2 regulate HepG2 cell proliferation and apoptosis via modulating cellular lipid droplet metabolism.

Authors - Yanjie Tan
Loading...
||
New chat Able
正在加载,请稍候...