Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

COX2/ Cyclooxygenase 2/ PTGS2 Polyclonal antibody

COX2/ Cyclooxygenase 2/ PTGS2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12375-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (4)

Applications

WB, IHC, IF/ICC, CoIP, ELISA

COX2, PTGS2, GRIPGHS, EC:1.14.99.1, Cyclooxygenase-2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, RAW 264.7 cells, HeLa cells, NIH/3T3 cells, HEK-293 cells, Raji cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA549 cells

COX-2 expression is undetectable in most normal tissues but dramatically upregulated during inflammation (PMID: 9249646, 18657230).

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12375-1-AP targets COX2/ Cyclooxygenase 2/ PTGS2 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig, monkey, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3025

Product name: Recombinant human COX2/ Cyclooxygenase 2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 20-366 aa of BC013734

Sequence: PCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCDVLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQNRIAAE

Predict reactive species
Full Name prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
Calculated Molecular Weight 604 aa, 68 kDa
Observed Molecular Weight 70-74 kDa
GenBank Accession NumberBC013734
Gene Symbol COX2/PTGS2
Gene ID (NCBI) 5743
RRIDAB_2085127
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP35354
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COX2 is an enzyme involved in the synthesis of prostaglandins from arachidonic acid.


1. What is the molecular weight of COX2?

The fully N-glycosylated PTGS2 is 72-74 kDa and the aglycosylated is 66 kDa (PMID:19656660). It also 

expresses a band of 39 kDa after unspecific cleavage (PMID:17509125). The 50 kDa band of fragmented 

PTGS2 has also previously been detected in AD brains (PMID:14724276).

2. Is COX2 post-translationally modified?

COX2 is a subject of post-translational modifications, including phosphorylation, glycosylation, and 

s-nitrosylation (PMID: 28939645).

3. What is the difference between COX1, COX2, and COX3?

There are three isoenzymes that have cyclooxygenase activity: COX1, COX2, and COX3. While COX1 

is a ubiquitously expressed constitutive enzyme, expression of COX2 is generally low but can be rapidly 

induced by various stimuli (as part of infection and inflammatory response) and is controlled by the 

transcription factor NFκB. COX3 is an alternative splice variant of COX1 enzyme and is considered 

non-functional in humans. 

4. I cannot detect COX2 in my sample during western blotting.

Unlike COX1, COX2 expression is inducible by a variety of stimuli including certain growth factors, cytokines, 

and proinflammatory stimuli. COX2 basal expression levels may be very low in unstimulated cells. Additionally, 

the COX2 half-life time is short and after stimulation, COX2 protein can be quickly degraded to basal levels 

(PMID: 10966456), which should be taken into account during experimental design.

5. What is the role of COX2 in cancer?

COX2 is often upregulated in various cancer types and increased expression of COX2 is associated with 

greater angiogenesis of solid tumors, increased invasion, and metastasis, as well as decreased host immunity.

6. What is subcellular localization of COX2?

Both COX1 and COX2 are present in the endoplasmic reticulum (ER) and nuclear envelope (PMID: 9545330), 

but COX2 has been reported to be more enriched in the nuclear envelope compared to COX1 (PMID: 7738031).


Protocols

Product Specific Protocols
IF protocol for COX2/ Cyclooxygenase 2/ PTGS2 antibody 12375-1-APDownload protocol
IHC protocol for COX2/ Cyclooxygenase 2/ PTGS2 antibody 12375-1-APDownload protocol
WB protocol for COX2/ Cyclooxygenase 2/ PTGS2 antibody 12375-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Signal Transduct Target Ther

Protein C receptor maintains cancer stem cell properties via activating lipid synthesis in nasopharyngeal carcinoma.

Authors - Panpan Zhang
humanWB

Signal Transduct Target Ther

Targeting cancer cell plasticity by HDAC inhibition to reverse EBV-induced dedifferentiation in nasopharyngeal carcinoma.

Authors - Jiajun Xie
human,mouseWB

Cell Metab

m6A mRNA methylation in brown fat regulates systemic insulin sensitivity via an inter-organ prostaglandin signaling axis independent of UCP1

Authors - Ling Xiao
human, monkeyWB,IF

Cell Metab

Vitamin C inhibits ACSL4 to alleviate ferro-aging in primates.

Authors - Lixiao Liu
ratIF

Adv Mater

Ultrasound Nanobubble Coupling Agent for Effective Non-Invasive Deep-Layer Drug Delivery

Authors - Xiaoyu Han
ratIF

Adv Mater

Sequential Targeted Enzyme-Instructed Self-Assembly Supramolecular Nanofibers to Attenuate Intervertebral Disc Degeneration

Authors - Yang Liu

Reviews

    4.6 out of 5
Add a review

6 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Meixin (Verified Customer) (03-10-2026)

Reliable antibody for WB. Clear band at the expected molecular weight and low background. The signal was strong and consistent.

  • Applications: Western Blot

Mounika (Verified Customer) (01-08-2026)

These antibodies are wonderful, worked very well1

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:700

Uthra (Verified Customer) (10-04-2022)

Paraffin-IHC from embedded mouse skin

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1 to 200
  • Cell Tissue Type: Skin
COX2/ Cyclooxygenase 2/ PTGS2 Antibody Immunohistochemistry validation (1 to 200 dilution) in Skin (Cat no:12375-1-AP)

Reema (Verified Customer) (09-07-2022)

The antibody works perfectly with WB

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: rat

Lena (Verified Customer) (02-21-2022)

Used for Paraffin-IHC from embedded mouse bones

  • Applications: Immunohistochemistry
  • Cell Tissue Type: IHC-P

Ryan (Verified Customer) (02-28-2019)

Tissue was fixed in PFA and no further antigen retrieval was necessary. Co-localisation in microglia shown with a known marker (magenta).

  • Applications: Immunohistochemistry, Immunofluorescence,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Zebrafish brain (microglia) at 3dpf
COX2/ Cyclooxygenase 2/ PTGS2 Antibody Immunohistochemistry,Immunofluorescence, validation (1:100 dilution) in Zebrafish brain (microglia) at 3dpf (Cat no:12375-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...