Use Able AI chat for product recommendations

PTPRF Polyclonal antibody

PTPRF Polyclonal Antibody for WB, ELISA

Cat No. 26860-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

EC:3.1.3.48, LAR, Receptor-type tyrosine-protein phosphatase F

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, MKN-45 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26860-1-AP targets PTPRF in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25448

Product name: Recombinant human PTPRF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1080-1150 aa of BC048768

Sequence: HLVSIRTAPDLLPHKPLPASAYIEDGRFDLSMPHVQDPSLVRWFYIVVVPIDRVGGSMLTPRWSTPEELEL

Predict reactive species
Full Name protein tyrosine phosphatase, receptor type, F
Calculated Molecular Weight 1898 aa, 212 kDa
Observed Molecular Weight70-72 kDa, 150 kDa
GenBank Accession NumberBC048768
Gene Symbol PTPRF
Gene ID (NCBI) 5792
RRIDAB_3742202
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP10586
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTPRF (Protein Tyrosine Phosphatase Receptor Type F) is a receptor protein tyrosine phosphatase, also known as LAR. PTPRF is a transmembrane protein with extracellular domain, transmembrane domain and two intracellular catalytic domains in series. It is located in the cell membrane and participates in the interaction between cells or cell matrix. It is widely expressed in many tissues, including fat, skin, heart, lung, liver, kidney, pancreas, small intestine, colon, brain, skeletal muscle, spleen, peripheral white blood cells and so on. The protein plays an important role in regulating a variety of cell processes, including cell growth, differentiation, mitotic cycle and carcinogenic transformation. In the insulin-responsive tissues of obese and insulin-resistant individuals, the expression level of PTPRF is increased, which may contribute to the pathogenesis of insulin resistance. PTPRF showed expression changes in many cancers, such as breast cancer, thyroid cancer, non-small cell lung cancer and so on. In gastric adenocarcinoma, PTPRF, as a new tumor suppressor, plays a role by inactivating ERK1/2 signaling pathway (PMID: 32973331). The total length of the protein is 175-200kd, and after cutting, it forms 125-150 and 80-85kd,70 and 72kDa fragments (PMID: 1547787, PMID: 17259169).

Protocols

Product Specific Protocols
WB protocol for PTPRF antibody 26860-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...