• Featured Product
  • KD/KO Validated

RAB27B Polyclonal antibody

RAB27B Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 13412-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, CoIP, ELISA

C25KG, EC:3.6.5.2, Ras related protein Rab 27B, Ras-related protein Rab-27B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat spleen tissue, A375 cells, DU 145 cells, MCF-7 cells, PC-3 cells
Positive IHC detected inrat stomach tissue, human breast cancer tissue, human colon cancer tissue, human liver cancer tissue, human oesophagus cancer tissue, human pancreas cancer tissue, human prostate cancer tissue, human testis tissue, mouse stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU-87 MG cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13412-1-AP targets RAB27B in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4064

Product name: Recombinant human RAB27B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-218 aa of BC027474

Sequence: MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC

Predict reactive species
Full Name RAB27B, member RAS oncogene family
Calculated Molecular Weight 218 aa, 25 kDa
Observed Molecular Weight 25-30 kDa
GenBank Accession NumberBC027474
Gene Symbol RAB27B
Gene ID (NCBI) 5874
RRIDAB_2176732
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO00194
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The Rab27 GTPase subfamily consists of two closely related homologs, Rab27a and Rab27b. Northern blot analysis revealed that Rab27b is expressed significantly only in testis, in which the predominant transcript was 1.4 kb in size. An 8-kb mRNA of unknown origin was detected in many tissues. Rab27b is associated with tubulovesicle membranes in the parietal cell and Rab27b may play a role in stimulation-associated membrane recruitment and gastric acid secretion. Rab27b is recently reported as a marker for breast cancer progression. It regulates invasive growth and metastasis in ER-positive breast cancer cell lines, and increased expression is associated with poor prognosis in humans.

Protocols

Product Specific Protocols
IF protocol for RAB27B antibody 13412-1-APDownload protocol
IHC protocol for RAB27B antibody 13412-1-APDownload protocol
WB protocol for RAB27B antibody 13412-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

Nature

Microenvironment-induced PTEN loss by exosomal microRNA primes brain metastasis outgrowth.

Authors - Lin Zhang
humanWB,IHC

Cell

Exosome transfer from stromal to breast cancer cells regulates therapy resistance pathways.

Authors - Mirjam C Boelens
humanWB

Immunity

MLKL, the Protein that Mediates Necroptosis, Also Regulates Endosomal Trafficking and Extracellular Vesicle Generation.

Authors - Seongmin Yoon
humanWB

Adv Sci (Weinh)

Exosome Release Is Regulated by mTORC1.

Authors - Wenchong Zou
mouseIF

Nat Commun

Identification of genes associated with cortical malformation using a transposon-mediated somatic mutagenesis screen in mice.

Authors - I-Ling Lu
humanWB

Nat Commun

Exosomes maintain cellular homeostasis by excreting harmful DNA from cells.

Authors - Akiko Takahashi

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Kacie (Verified Customer) (09-12-2022)

Antibody works well for both ICC and WB.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: M17 Cells
Loading...
||
New chat Able
正在加载,请稍候...