RACK1; GNB2L1 Polyclonal antibody

• 

  WB analysis using 27592-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27592-1-AP (RACK1; GNB2L1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27592-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27592-1-AP (RACK1; GNB2L1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 27592-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27592-1-AP (RACK1; GNB2L1 antibody) at dilution of 1:800 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 27592-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27592-1-AP (RACK1; GNB2L1 antibody) at dilution of 1:800 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 27592-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 27592-1-AP (RACK1; GNB2L1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 27592-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 27592-1-AP (RACK1; GNB2L1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

RACK1; GNB2L1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27592-1-AP

Publications(19)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat and More (3)

Applications

WB, IHC, IF, IP, CoIP, RIP, ELISA

Synonyms

Gnb2 rs1, GNB2L1, H12.3, HLC 7, PIG21, RACK1, RACK1; GNB2L1

---

Tested Applications

• Positive WB detected in: mouse liver tissue, L02 cells, HepG2 cells, rat liver tissue
• Positive IHC detected in: human liver cancer tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 19 publications below
• IHC: See 1 publications below
• IF: See 2 publications below
• IP: See 4 publications below
• CoIP: See 2 publications below
• RIP: See 1 publications below

Product Information

27592-1-AP targets RACK1; GNB2L1 in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Cited Reactivity: human, mouse, pig, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26708

  Product name: Recombinant human RACK1; GNB2L1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 131-317 aa of BC019093

  Sequence: LWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTIGTR

• Full Name: guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC019093
• Gene Symbol: RACK1
• Gene ID (NCBI): 10399
• RRID: AB_2880917
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P63244
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Members of the protein kinase C (PKC) family play a key regulatory role in a variety of cellular functions, including cell growth and differentiation, gene expression, hormone secretion and membrane function. RACK1 (receptor for activated protein kinase C 1), encoded by GNB2L1 gene, is a 317 amino acid guanine nucleotide-binding protein subunit beta-2-like 1 protein which is involved in the recruitment, assembly and/or regulation of a variety of signaling molecules, it contains 7 WD-repeats and is implicated in various protein interaction activities. RACK1 is a component of the 40S ribosomal subunit involved in translational repression. Recent finding suggests that RACK1 may be a new promising diagnosis biomarker and therapeutic target for non-small-cell lung cancer (NSCLC).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,CoIP	J Clin Invest; CAP2 promotes gastric cancer metastasis by mediating the interaction between tumor cells and tumor-associated macrophages; Authors - Guohao Zhang
mouse	WB	Acta Pharmacol Sin; OTUD1 deficiency attenuates myocardial ischemia/reperfusion induced cardiomyocyte apoptosis by regulating RACK1 phosphorylation; Authors - Yue Luo
human,mouse	WB	Cells; Modification of RNF183 via m6A Methylation Mediates Podocyte Dysfunction in Diabetic Nephropathy by Regulating PKM2 Ubiquitination and Degradation; Authors - Dongwei Guo
human	WB,IP,IF	Mol Med; LRP11 facilitates lipid metabolism and malignancy in hepatocellular carcinoma by stabilizing RACK1 through USP5 regulation; Authors - Litao Liang
human	WB,IF,IP	J Virol; The matrix protein of respiratory syncytial virus suppresses interferon signaling via RACK1 association; Authors - Jingjing Cao
	WB	Cancers (Basel); RACK1 Promotes Meningioma Progression by Activation of NF-κB Pathway via Preventing CSNK2B from Ubiquitination Degradation; Authors - Ali Abdi Maalim