Tested Applications
| Positive WB detected in | Raji cells |
| Positive IHC detected in | human stomach cancer tissue, human colon tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23408-1-AP targets TNFSF11/RANKL in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19975 Product name: Recombinant human RANKL protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 76-317 aa of BC074890 Sequence: PNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID Predict reactive species |
| Full Name | tumor necrosis factor (ligand) superfamily, member 11 |
| Calculated Molecular Weight | 317 aa, 35 kDa |
| Observed Molecular Weight | 20-30 kDa |
| GenBank Accession Number | BC074890 |
| Gene Symbol | RANKL |
| Gene ID (NCBI) | 8600 |
| RRID | AB_2879273 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14788 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TNFSF11 also known as RANKL, is a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. RANKL is a polypeptide of 217 amino acids that exerts its biological activity both in a transmembrane form of about 40-45 kDa and in soluble one of 31 kDa (PMID: 15308315). The membrane-bound RANKL (mRANKL) is cleaved into a sRANKL by the metalloprotease-disintegrin TNF-alpha convertase (TACE) or a related metalloprotease (MP). RANKL induces osteoclast formation through its receptor, RANK, which transduces signals by recruiting adaptor molecules, such as the TNF receptor-associated factor (TRAF) family of proteins. RANKL was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. RANKL was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TNFSF11/RANKL antibody 23408-1-AP | Download protocol |
| WB protocol for TNFSF11/RANKL antibody 23408-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TNFSF11/RANKL Polyclonal antibody (Cat# 23408-1-AP) has accumulated 101 citations across more than 70 journals, including Nature Communications, Advanced Science, Arthritis & Rheumatology, FASEB Journal, and Signal Transduction and Targeted Therapy. Key research fields include bone biology (osteoporosis, osteoarthritis, fracture healing), rheumatoid arthritis, vascular calcification, periodontal disease, orthodontic tooth movement, cancer bone metastasis, inflammatory diseases, renal disease, and environmental toxicology.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Targeting N(1)-methyladenosine modification in osteoblasts through tRNA methyltransferase 10C reverses mitochondrial dysfunction and ameliorates osteoporosis. | ||
Bioact Mater A parathyroid hormone related supramolecular peptide for multi-functionalized osteoregeneration | ||
J Extracell Vesicles Exosomes derived from osteogenic tumor activate osteoclast differentiation and concurrently inhibit osteogenesis by transferring COL1A1-targeting miRNA-92a-1-5p. | ||
Bone Res A RANKL(+)/CXCR4(+) B cell population accumulates in bone marrow and causes age-related osteoporosis in mice. | ||
Nat Commun Denosumab attenuates knee osteoarthritis progression by inhibiting synovial inflammation via the RANK/TRAF6/FSTL1 signalling. | ||
Nat Commun Rescuing SERCA2 pump deficiency improves bone mechano-responsiveness in type 2 diabetes by shaping osteocyte calcium dynamics |
