TNFSF11/RANKL Polyclonal antibody

TNFSF11/RANKL Polyclonal Antibody for WB, IHC, ELISA
Cat No. 23408-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, ELISA

TNFSF11, Tumor necrosis factor ligand superfamily member 11, TNF-related activation-induced cytokine, Receptor activator of nuclear factor kappa-B ligand, CD254

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRaji cells
Positive IHC detected inhuman stomach cancer tissue, human colon tissue, human heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23408-1-AP targets TNFSF11/RANKL in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19975

Product name: Recombinant human RANKL protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 76-317 aa of BC074890

Sequence: PNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

Predict reactive species
Full Name tumor necrosis factor (ligand) superfamily, member 11
Calculated Molecular Weight 317 aa, 35 kDa
Observed Molecular Weight20-30 kDa
GenBank Accession NumberBC074890
Gene Symbol RANKL
Gene ID (NCBI) 8600
RRIDAB_2879273
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO14788
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TNFSF11 also known as RANKL, is a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. RANKL is a polypeptide of 217 amino acids that exerts its biological activity both in a transmembrane form of about 40-45 kDa and in soluble one of 31 kDa (PMID: 15308315). The membrane-bound RANKL (mRANKL) is cleaved into a sRANKL by the metalloprotease-disintegrin TNF-alpha convertase (TACE) or a related metalloprotease (MP). RANKL induces osteoclast formation through its receptor, RANK, which transduces signals by recruiting adaptor molecules, such as the TNF receptor-associated factor (TRAF) family of proteins. RANKL was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. RANKL was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis.

Protocols

Product Specific Protocols
IHC protocol for TNFSF11/RANKL antibody 23408-1-APDownload protocol
WB protocol for TNFSF11/RANKL antibody 23408-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Extracell Vesicles

Exosomes derived from osteogenic tumor activate osteoclast differentiation and concurrently inhibit osteogenesis by transferring COL1A1-targeting miRNA-92a-1-5p.

Authors - Lijuan Yu
mouse,humanWB

Aging Cell

Pyrroloquinoline quinone alleviates natural aging-related osteoporosis via a novel MCM3-Keap1-Nrf2 axis-mediated stress response and Fbn1 upregulation

Authors - Jie Li
ratIF

J Control Release

Sialic acid-modified chitosan oligosaccharide-based biphasic calcium phosphate promote synergetic bone formation in rheumatoid arthritis therapy.

Authors - Xiao-Ling Xu
mouseWB

Antioxid Redox Signal

Titanium Particles Activate Osteocytic Connexin 43 to Induce Oxidative Stress and Osteoclastogenesis Through the JAK-STAT Pathway

Authors - Jiawei Ouyang
mouseWB

Mol Metab

Loss of chemerin triggers bone remodeling in vivo and in vitro.

Authors - Long Han
mouseWB

Aging (Albany NY)

Increased expression of osteopontin in subchondral bone promotes bone turnover and remodeling, and accelerates the progression of OA in a mouse model.

Authors - Chuangxin Lin
Loading...
||
New chat

Able

正在加载,请稍候...