TNFSF11/RANKL Polyclonal antibody

• 

  WB analysis using 23408-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23408-1-AP (RANKL antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 23408-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 23408-1-AP (RANKL antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 23408-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 23408-1-AP (RANKL antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 23408-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 23408-1-AP (RANKL antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human colon using 23408-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 23408-1-AP (RANKL antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human heart using 23408-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 23408-1-AP (RANKL antibody) at dilution of 1:200 (under 10x lens).

TNFSF11/RANKL Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23408-1-AP

Publications(74)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

TNFSF11, Tumor necrosis factor ligand superfamily member 11, TNF-related activation-induced cytokine, Receptor activator of nuclear factor kappa-B ligand, CD254

---

Tested Applications

• Positive WB detected in: Raji cells
• Positive IHC detected in: human stomach cancer tissue, human colon tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 48 publications below
• IHC: See 26 publications below
• IF: See 10 publications below

Product Information

23408-1-AP targets TNFSF11/RANKL in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19975

  Product name: Recombinant human RANKL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 76-317 aa of BC074890

  Sequence: PNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

• Full Name: tumor necrosis factor (ligand) superfamily, member 11
• Calculated Molecular Weight: 317 aa, 35 kDa
• Observed Molecular Weight: 20-30 kDa
• GenBank Accession Number: BC074890
• Gene Symbol: RANKL
• Gene ID (NCBI): 8600
• RRID: AB_2879273
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14788
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TNFSF11 also known as RANKL, is a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. RANKL is a polypeptide of 217 amino acids that exerts its biological activity both in a transmembrane form of about 40-45 kDa and in soluble one of 31 kDa (PMID: 15308315). The membrane-bound RANKL (mRANKL) is cleaved into a sRANKL by the metalloprotease-disintegrin TNF-alpha convertase (TACE) or a related metalloprotease (MP). RANKL induces osteoclast formation through its receptor, RANK, which transduces signals by recruiting adaptor molecules, such as the TNF receptor-associated factor (TRAF) family of proteins. RANKL was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. RANKL was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Extracell Vesicles; Exosomes derived from osteogenic tumor activate osteoclast differentiation and concurrently inhibit osteogenesis by transferring COL1A1-targeting miRNA-92a-1-5p.; Authors - Lijuan Yu
mouse,human	WB	Aging Cell; Pyrroloquinoline quinone alleviates natural aging-related osteoporosis via a novel MCM3-Keap1-Nrf2 axis-mediated stress response and Fbn1 upregulation; Authors - Jie Li
rat	IF	J Control Release; Sialic acid-modified chitosan oligosaccharide-based biphasic calcium phosphate promote synergetic bone formation in rheumatoid arthritis therapy.; Authors - Xiao-Ling Xu
mouse	WB	Antioxid Redox Signal; Titanium Particles Activate Osteocytic Connexin 43 to Induce Oxidative Stress and Osteoclastogenesis Through the JAK-STAT Pathway; Authors - Jiawei Ouyang
mouse	WB	Mol Metab; Loss of chemerin triggers bone remodeling in vivo and in vitro.; Authors - Long Han
mouse	WB	Aging (Albany NY); Increased expression of osteopontin in subchondral bone promotes bone turnover and remodeling, and accelerates the progression of OA in a mouse model.; Authors - Chuangxin Lin