RBP4 Polyclonal antibody

RBP4 Polyclonal Antibody for WB, ELISA
Cat No. 32392-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Plasma retinol-binding protein, PRBP, RBP, Retinol-binding protein 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, mouse liver tissue, rat heart tissue, rat liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

32392-1-AP targets RBP4 in WB, ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Eg1140

Product name: Recombinant Mouse RBP4 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 19-201 aa of NM_011255.3

Sequence: ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL

Predict reactive species
Full Name retinol binding protein 4, plasma
Calculated Molecular Weight23kDa
Observed Molecular Weight17-21 kDa
GenBank Accession NumberNM_011255.3
Gene Symbol Rbp4
Gene ID (NCBI) 19662
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ00724
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RBP4 (retinol-binding protein 4) is a carrier protein that transports vitamin A (retinol) from the liver to the peripheral tissues. Synthesized primarily by hepatocytes and adipocytes as a 21 kDa non-glycosylated protein, RBP4 is secreted into the circulation as a retinol-RBP4 complex. In plasma the RBP4-retinol complex is bound to transthyretin (TRR), which prevents prevent kidney filtration. Two truncated forms of RBP4, RBP4-L (truncated at Leu-183) and RBP4-LL (truncated at Leu-182 and Leu-183), exist by proteolytic process. RBP4-L and RBP4-LL, which do not bind TTR, are normally excreted into the urine but accumulate in the serum during renal failure. Urinary RBP4 has been reported as marker for glomerular disease. RBP4 also was identified as an adipokine that elevated in some INS-resistant states. Measurement of serum RBP4 could be used to assess the risk of INS resistance, type 2 diabetes, obesity, and cardiovascular disease. (18752671, 16034410)

Protocols

Product Specific Protocols
WB protocol for RBP4 antibody 32392-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...