RSAD2 Polyclonal antibody

• 

RSAD2 Polyclonal Antibody for ELISA

Cat No. 11833-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

mouse, human, rat and More (1)

Applications

WB, ELISA

Synonyms

2510004L01Rik, cig33, cig5, RSAD2, vig1, Viperin

---

Published Applications

• WB: See 10 publications below

Product Information

11833-1-AP targets RSAD2 in WB, ELISA applications and shows reactivity with mouse, human, rat samples.

• Tested Reactivity: mouse, human, rat
• Cited Reactivity: human, mouse, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2409

  Product name: Recombinant human RSAD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-361 aa of BC017969

  Sequence: MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLRATKRRKQQLVLRGPDETKEEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW

• Full Name: radical S-adenosyl methionine domain containing 2
• Calculated Molecular Weight: 361 aa, 42 kDa
• GenBank Accession Number: BC017969
• Gene Symbol: RSAD2
• Gene ID (NCBI): 91543
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WXG1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RSAD2 (radical S-adenosyl methionine domain-containing protein 2), also known as CIG5 (cytomegalovirus-induced gene 5 protein), vig1, viperin or CIG33, displays antiviral effect against HIV-1 virus, hepatitis C virus, human cytomegalovirus, and aphaviruses. Expression of the protein can be induced by interferon. Western blot analysis of IFNG-treated cells revealed 43 kD/35kd bands.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Signal Transduct Target Ther; TRAF3 activates STING-mediated suppression of EV-A71 and target of viral evasion; Authors - Wenwen Zheng
human	WB	Cell Host Microbe; PMID: 26159719; Authors - Kirk J Lubick
bovine	WB	mBio; The Timing and Magnitude of the Type I Interferon Response Are Correlated with Disease Tolerance in Arbovirus Infection; Authors - Alexandra Hardy
human	WB	Eur Respir J; PMID: 20150207; Authors - Gielen V V
human,mouse	WB	J Neuroinflammation; Progression of pathology in PINK1-deficient mouse brain from splicing via ubiquitination, ER stress, and mitophagy changes to neuroinflammation.; Authors - Sylvia Torres-Odio
human	WB	J Virol; Identification of alpha interferon-induced genes associated with antiviral activity in Daudi cells and characterization of IFIT3 as a novel antiviral gene.; Authors - Schmeisser H H