RanGAP1 Polyclonal antibody

• 

  WB analysis of SKOV-3 using 27405-1-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 27405-1-AP (RANGAP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27405-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27405-1-AP (RanGAP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Neuro-2a using 27405-1-AP

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 27405-1-AP (RANGAP1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 27405-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 27405-1-AP (RANGAP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 27405-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 27405-1-AP (RANGAP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach using 27405-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 27405-1-AP (RanGAP1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RanGAP1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27405-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

SD, Ran GTPase-activating protein 1, KIAA1835

---

Tested Applications

• Positive WB detected in: HEK-293 cells, MCF-7 cells, Neuro-2a cells, SKOV-3 cells, NIH/3T3 cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 1 publications below

Product Information

27405-1-AP targets RanGAP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26128

  Product name: Recombinant human RANGAP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-220 aa of BC014044

  Sequence: ASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGI

• Full Name: Ran GTPase activating protein 1
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 64 kDa, 82 kDa
• GenBank Accession Number: BC014044
• Gene Symbol: RANGAP1
• Gene ID (NCBI): 5905
• RRID: AB_2880863
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P46060
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RanGAP1 is a protein that associates with the nuclear pore complex and participates in the regulation of nuclear transport. In mammalian cells, unmodified RanGAP1 is predominantly cytoplasmic, whereas modification by small ubiquitin-related modifier protein (SUMO) targets RanGAP1 to the cytoplasmic filaments of nuclear pore complex (NPC) where it forms a complex with RanBP2 and Ubc9. Phosphorylation of RanGAP1 occurs in a cell-cycle-dependent manner and may play a role in regulating RanGAP1 catalytic activity. We got 64 kDa (cytoplasmic Ran GAP1) and 82 kDa (SUMO-1 modified Ran GAP1) in western blotting.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cell Biol; An ARF6-Exportin-5 axis delivers pre-miRNA cargo to tumour microvesicles.; Authors - James W Clancy
mouse	WB,IF	iScience; Characterizing the differential distribution and targets of Sumo1 and Sumo2 in the mouse brain; Authors - Terry R Suk