SAE1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SAE1 Polyclonal antibody (10229-1-AP)

SAE1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10229-1-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

SUMO-activating enzyme subunit 1, N-terminally processed, SUMO-activating enzyme subunit 1, SUA1, Sentrin/SUMO activating protein AOS1, HSPC140

• 

  WB analysis of A431 using 10229-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 10229-1-AP (SAE1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10229-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10229-1-AP (SAE1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10229-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10229-1-AP (SAE1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 10229-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 10229-1-AP (SAE1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10229-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10229-1-AP (SAE1 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10229-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10229-1-AP (SAE1 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 10229-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 10229-1-AP (SAE1 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 10229-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 10229-1-AP (SAE1 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 10229-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using SAE1 antibody (10229-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SAE1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, A431 cells, HEK-293 cells, HeLa cells
• Positive IHC detected in: human colon cancer tissue, human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:5000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10229-1-AP targets SAE1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0275

  Product name: Recombinant human SAE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-207 aa of BC000344

  Sequence: MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMV

• Full Name: SUMO1 activating enzyme subunit 1
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC000344
• Gene Symbol: SAE1
• Gene ID (NCBI): 10055
• RRID: AB_2182917
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBE0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SAE1(SUMO-activating enzyme subunit 1) is also named as AOS1, SUA1, UBLE1A and belongs to the ubiquitin-activating E1 family. SAE1 has a calculated molecular mass of 38 kD. It had an apparent molecular mass of 40 kD by SDS-PAGE. SAE1 and UBA2 form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins(PMID:9920803). Western blot analysis of synchronized HeLa cells detectes increased AOS1 expression as cells progressed through S phase, followed by a substantial decrease in G2 phase. Immunofluorescence analysis shows AOS1 and UBA2 distributed throughout nuclei, but they are excluded from nucleoli.(PMID:11481243).

Publications

What published studies show

The SAE1 Polyclonal antibody (Cat# 10229-1-AP) has 9 citations across journals including Nature Communications, Gut Microbes, Current Biology, Biochemical Pharmacology, Oncoimmunology, Current Issues in Molecular Biology, Open Medicine, eLife, and Ecotoxicology and Environmental Safety. Research fields span SUMOylation, steatohepatitis, intestinal inflammation, spermatogenesis, diabetic nephropathy, pancreatic cancer, colorectal cancer, hepatocellular carcinoma, and HIV-1 latency, with applications mainly in WB, IHC, and IF.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; SENP1 prevents steatohepatitis by suppressing RIPK1-driven apoptosis and inflammation; Authors - Lingjie Yan
human	WB	Gut Microbes; Staphylococcus warneri dampens SUMOylation and promotes intestinal inflammation.; Authors - Léa Loison
mouse	WB	Curr Biol; Pumilio 1 suppresses multiple activators of p53 to safeguard spermatogenesis.; Authors - Dong Chen
human	WB,IHC,IF	Biochem Pharmacol; Increased SUMO-activating enzyme subunit 1 promotes glycolysis and fibrotic phenotype of diabetic nephropathy; Authors - Reziwanguli Wusiman
mouse	WB,IHC,IF	Oncoimmunology; Mild microwave hyperthermia promotes mitotic catastrophe, induces time-delayed cGAS-STING activation and restores sensitivity to anti-PDL1 therapy in Pan02 pancreatic cancer model.; Authors - Na Li
human	IHC,WB	Curr Issues Mol Biol; SUMO-Activating Enzyme Subunit 1 Is Associated with Poor Prognosis, Tumor Progression, and Radio-Resistance in Colorectal Cancer; Authors - Yueh-Jung Wu