SCNN1A Polyclonal antibody

• 

  WB analysis of HEK-293 using 10924-2-AP

  WB result of SCNN1A (10924-2-AP, 1:1000) with si-control and si-SCNN1A transfected HEK293 cells.

• 

  WB analysis of PC-13 using 10924-2-AP

  PC-13 cells were subjected to SDS PAGE followed by western blot with 10924-2-AP (SCNN1A Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 10924-2-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 10924-2-AP (SCNN1A Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 10924-2-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 10924-2-AP (SCNN1A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 10924-2-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10924-2-AP (SCNN1A Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 10924-2-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10924-2-AP (SCNN1A Antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of A549 using 10924-2-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed A549 cells using 10924-2-AP (SCNN1A antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

SCNN1A Polyclonal Antibody for WB, IF, IHC, ELISA

Cat No. 10924-2-AP

Publications(15)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IHC, ELISA

Synonyms

Alpha ENaC, Alpha NaCH, ENaCa, ENaCalpha, SCNEA, SCNN1, SCNN1A

---

Tested Applications

• Positive WB detected in: PC-13 cells, HEK-293
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 10 publications below
• IHC: See 7 publications below

Product Information

10924-2-AP targets SCNN1A in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1325

  Product name: Recombinant human SCNN1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 363-711 aa of BC006526

  Sequence: MPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRPQNVEYCDYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRWPSVTSQEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVIMFLMLLRRFRSRYWSPGRGGRGAQEVASTLASSPPSHFCPHPMSLSLSQPGPAPSPALTAPPPAYATLGPRPSPGGSAGASSSTCPLGGP

• Full Name: sodium channel, nonvoltage-gated 1 alpha
• Calculated Molecular Weight: 76 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC006526
• Gene Symbol: SCNN1A
• Gene ID (NCBI): 6337
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P37088
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SCNN1A (sodium channel, non-voltage-gated 1 alpha), also known as ENaCA (epithelial Na(+) channel subunit alpha) or amiloride-sensitive sodium channel subunit alpha, is the alpha subunit of the epithelial Na(+) channel (ENaC). ENaC is expressed in the apical membrane of salt-absorbing epithelia of kidney, distal colon, and lung. ENaC is a non-voltage gated, constitutively active channel highly selective for sodium. It has an essential role in salt and fluid homeostasis across epithelial tissues. ENaC consists of three different subunits: alpha, beta, gamma. Mutations in the gene of SCNN1A have been associated with pseudohypoaldosteronism type 1 (PHA1), a rare salt wasting disease resulting from target organ unresponsiveness to mineralocorticoids. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. It has been reported that full-length SCNN1A protein can be cleaved into 65- and 30-kDa fragments (PMID: 16477034; 18701608).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Am J Respir Crit Care Med; SPX-101 is a Novel ENaC-targeted Therapeutic for Cystic Fibrosis that Restores Mucus Transport.; Authors - David W Scott
mouse	IHC	Sci Adv; MLL4 mediates differentiation and tumor suppression through ferroptosis.; Authors - Shaun Egolf
mouse	WB	Hypertension; Renal Natriuretic Peptide Receptor-C Deficiency Attenuates NaCl Cotransporter Activity in Angiotensin II-Induced Hypertension.; Authors - Shuai Shao
	IHC	Sci Rep; Distribution of aquaporins and sodium transporters in the gastrointestinal tract of a desert hare, Lepus yarkandensis.; Authors - Jianping Zhang
human	WB	Biomed Pharmacother; PMID: 31203134; Authors - Wei-Hua He
human	WB,IHC	PLoS One; Reduced Expression of Enac in Placenta Tissues of Patients with Severe Preeclampsia Is Related to Compromised Trophoblastic Cell Migration and Invasion during Pregnancy.; Authors - Wang Shan S