• Featured Product
  • KD/KO Validated

SCNN1A Polyclonal antibody

SCNN1A Polyclonal Antibody for WB, IF, IHC, ELISA
Cat No. 10924-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IHC, ELISA

Alpha ENaC, Alpha NaCH, ENaCa, ENaCalpha, SCNEA, SCNN1, SCNN1A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPC-13 cells, HEK-293
Positive IHC detected inhuman kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10924-2-AP targets SCNN1A in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1325

Product name: Recombinant human SCNN1A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 363-711 aa of BC006526

Sequence: MPGINNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRPQNVEYCDYRKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRWPSVTSQEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVIMFLMLLRRFRSRYWSPGRGGRGAQEVASTLASSPPSHFCPHPMSLSLSQPGPAPSPALTAPPPAYATLGPRPSPGGSAGASSSTCPLGGP

Predict reactive species
Full Name sodium channel, nonvoltage-gated 1 alpha
Calculated Molecular Weight 76 kDa
Observed Molecular Weight 60-70 kDa
GenBank Accession NumberBC006526
Gene Symbol SCNN1A
Gene ID (NCBI) 6337
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP37088
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SCNN1A (sodium channel, non-voltage-gated 1 alpha), also known as ENaCA (epithelial Na(+) channel subunit alpha) or amiloride-sensitive sodium channel subunit alpha, is the alpha subunit of the epithelial Na(+) channel (ENaC). ENaC is expressed in the apical membrane of salt-absorbing epithelia of kidney, distal colon, and lung. ENaC is a non-voltage gated, constitutively active channel highly selective for sodium. It has an essential role in salt and fluid homeostasis across epithelial tissues. ENaC consists of three different subunits: alpha, beta, gamma. Mutations in the gene of SCNN1A have been associated with pseudohypoaldosteronism type 1 (PHA1), a rare salt wasting disease resulting from target organ unresponsiveness to mineralocorticoids. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. It has been reported that full-length SCNN1A protein can be cleaved into 65- and 30-kDa fragments (PMID: 16477034; 18701608).

Protocols

Product Specific Protocols
IF protocol for SCNN1A antibody 10924-2-APDownload protocol
IHC protocol for SCNN1A antibody 10924-2-APDownload protocol
WB protocol for SCNN1A antibody 10924-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Am J Respir Crit Care Med

SPX-101 is a Novel ENaC-targeted Therapeutic for Cystic Fibrosis that Restores Mucus Transport.

Authors - David W Scott
mouseIHC

Sci Adv

MLL4 mediates differentiation and tumor suppression through ferroptosis.

Authors - Shaun Egolf
mouseWB

Hypertension

Renal Natriuretic Peptide Receptor-C Deficiency Attenuates NaCl Cotransporter Activity in Angiotensin II-Induced Hypertension.

Authors - Shuai Shao
IHC

Sci Rep

Distribution of aquaporins and sodium transporters in the gastrointestinal tract of a desert hare, Lepus yarkandensis.

Authors - Jianping Zhang
humanWB

Biomed Pharmacother

PMID: 31203134

Authors - Wei-Hua He
humanWB,IHC

PLoS One

Reduced Expression of Enac in Placenta Tissues of Patients with Severe Preeclampsia Is Related to Compromised Trophoblastic Cell Migration and Invasion during Pregnancy.

Authors - Wang Shan S
Loading...
||
New chat Able
正在加载,请稍候...