Syntenin-1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Syntenin-1 Polyclonal antibody (22399-1-AP)

• Featured Product
• KD/KO Validated

Syntenin-1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 22399-1-AP Copied!

Publications (44)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

SDCBP, MDA 9, MDA9, MDA-9, Melanoma differentiation-associated protein 9

• 

  WB analysis using 22399-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22399-1-AP (Syntenin-1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 22399-1-AP

  WB result of Syntenin-1 antibody (22399-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Syntenin-1 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 22399-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22399-1-AP (Syntenin-1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 22399-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 22399-1-AP (Syntenin-1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 22399-1-AP

  IP result of anti-Syntenin-1 (IP:22399-1-AP, 3ug; Detection:22399-1-AP 1:1000) with HeLa cells lysate 2500ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 22399-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 22399-1-AP (Syntenin-1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 22399-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 22399-1-AP (Syntenin-1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 22399-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart slide using 22399-1-AP (Syntenin-1 antibody at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 22399-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart slide using 22399-1-AP (Syntenin-1 antibody at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 22399-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22399-1-AP (Syntenin-1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 22399-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22399-1-AP (Syntenin-1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 22399-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using Syntenin-1 antibody (22399-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Syntenin-1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, human placenta tissue, HeLa cells, HepG2 cells, MCF-7 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human liver cancer tissue, mouse brain tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22399-1-AP targets Syntenin-1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18078

  Product name: Recombinant human SDCBP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 12-139 aa of BC113674

  Sequence: VDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQ

• Full Name: syndecan binding protein (syntenin)
• Calculated Molecular Weight: 298 aa, 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC113674
• Gene Symbol: Syntenin-1
• Gene ID (NCBI): 6386
• RRID: AB_2879100
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00560
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Syntenin-1, also known as SDCBP (syndecan binding protein) and MDA-9 (melanoma differentiation-associated protein 9), was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. Syntenin-1 is a PDZ-domain-containing molecule that has many interaction partners, and regulates transmembrane-receptor trafficking, cell adhesion, tumor-cell metastasis and neuronal-synapse function. Syntenin-1 is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus.

Publications

What published studies show

Anti-Syntenin-1 Polyclonal antibody (Cat# 22399-1-AP) has accumulated 44 citations across prestigious journals including Cell, Nature Methods, Nature Communications, Cell Research, Cell Metabolism, Cell Discovery, EMBO Journal, and Journal of Biological Chemistry. The research fields encompassed by these citations include extracellular vesicle and exosome biology, cancer progression and metastasis, autophagy, neuroinflammation, viral infections, pulmonary fibrosis, and immune regulation.

Automatically generated from the 44 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell; Transplantation of gasdermin pores by extracellular vesicles propagates pyroptosis to bystander cells; Authors - Skylar S Wright
human	WB	Cell Metab; Arachidonic acid triggers spermidine synthase secretion from primary tumor to induce skeletal muscle weakness upon irradiation; Authors - Xiaohui Zhang
human	WB	Cell Res; RAB31 marks and controls an ESCRT-independent exosome pathway.; Authors - Denghui Wei ; KO Validated
mouse,human	WB	Cell Res; Intercellular transfer of activated STING triggered by RAB22A-mediated non-canonical autophagy promotes antitumor immunity; Authors - Ying Gao
human	WB	Nat Methods; SEVtras delineates small extracellular vesicles at droplet resolution from single-cell transcriptomes; Authors - Ruiqiao He
		J Extracell Vesicles; Identification of a Biomarker Panel in Extracellular Vesicles Derived From Non-Small Cell Lung Cancer (NSCLC) Through Proteomic Analysis and Machine Learning; Authors - Ye Yuan