Tested Applications
| Positive WB detected in | A549 cells, human placenta tissue, HeLa cells, HepG2 cells, MCF-7 cells | 
| Positive IP detected in | HeLa cells | 
| Positive IHC detected in | human liver cancer tissue, mouse brain tissue,  human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | HeLa cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 6 publications below | 
| WB | See 21 publications below | 
| IHC | See 2 publications below | 
Product Information
22399-1-AP targets Syntenin-1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse | 
| Cited Reactivity | human, mouse, monkey | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag18078 Product name: Recombinant human SDCBP protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 12-139 aa of BC113674 Sequence: VDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQ Predict reactive species | 
                                    
| Full Name | syndecan binding protein (syntenin) | 
| Calculated Molecular Weight | 298 aa, 32 kDa | 
| Observed Molecular Weight | 32 kDa | 
| GenBank Accession Number | BC113674 | 
| Gene Symbol | Syntenin-1 | 
| Gene ID (NCBI) | 6386 | 
| RRID | AB_2879100 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | O00560 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
Syntenin-1, also known as SDCBP (syndecan binding protein) and MDA-9 (melanoma differentiation-associated protein 9), was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. Syntenin-1 is a PDZ-domain-containing molecule that has many interaction partners, and regulates transmembrane-receptor trafficking, cell adhesion, tumor-cell metastasis and neuronal-synapse function. Syntenin-1 is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Syntenin-1 antibody 22399-1-AP | Download protocol | 
| IHC protocol for Syntenin-1 antibody 22399-1-AP | Download protocol | 
| IP protocol for Syntenin-1 antibody 22399-1-AP | Download protocol | 
| WB protocol for Syntenin-1 antibody 22399-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Cell Res Intercellular transfer of activated STING triggered by RAB22A-mediated non-canonical autophagy promotes antitumor immunity | ||
EMBO J Extracellular vesicles from Zika virus-infected cells display viral E protein that binds ZIKV-neutralizing antibodies to prevent infection enhancement
  | ||
Cell Mol Life Sci Exosomes from TNF-α preconditioned human umbilical cord mesenchymal stromal cells inhibit the autophagy of acinar cells of severe acute pancreatitis via shuttling bioactive metabolites | ||
Cell Oncol (Dordr) Circular RNA circNFATC3 acts as a miR-9-5p sponge to promote cervical cancer development by upregulating SDC2. | ||
Cell Oncol (Dordr) EV-miRome-wide profiling uncovers miR-320c for detecting metastatic colorectal cancer and monitoring the therapeutic response. | 





















