Tested Applications
| Positive WB detected in | HUVEC cells |
| Positive IHC detected in | human appendicitis tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20894-1-AP targets E-selectin/CD62E in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14944 Product name: Recombinant human SELE protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 22-371 aa of BC142711 Sequence: WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALS Predict reactive species |
| Full Name | selectin E |
| Calculated Molecular Weight | 610 aa, 67 kDa |
| Observed Molecular Weight | 115 kDa |
| GenBank Accession Number | BC142711 |
| Gene Symbol | CD62E |
| Gene ID (NCBI) | 6401 |
| RRID | AB_10755287 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P16581 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
E-selectin, also known as ELAM-1 or CD62E, is a member of the selectin family of adhesion molecules that also includes L-selectin and P-selectin. E-selectin is an inducible endothelial cell surface molecule. Its expression on endothelial cells is transcriptionally upregulated by various proinflammatory substances such as IL-1, TNFα and lipopolysaccharide (LPS). Besides, it can be secreted by endothelial cells, and can be detected in a soluble form (sE-selectin) in serum. During inflammation, E-selectin plays an important part in recruiting leukocytes to the site of injury. (PMID: 2827173; 1382417; 8943958)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for E-selectin/CD62E antibody 20894-1-AP | Download protocol |
| WB protocol for E-selectin/CD62E antibody 20894-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The E-selectin/CD62E Polyclonal antibody (Cat# 20894-1-AP) has 56 citations. They appear in journals including Nature Communications, Advanced Science, Science Advances, Cell Death & Differentiation, Cell Death & Disease, Small, Journal of Neuroinflammation, International Journal of Molecular Sciences, International Immunopharmacology, Frontiers in Cell and Developmental Biology, Cancers, and BMC Cardiovascular Disorders. Research fields center on vascular/endothelial biology, inflammation, atherosclerosis, sepsis, stroke, and cancer, with applications mainly in WB, IF, and IHC.
| Species | Application | Title |
|---|---|---|
Nat Commun Ubiquitin ligase CHFR mediated degradation of VE-cadherin through ubiquitylation disrupts endothelial adherens junctions | ||
Adv Sci (Weinh) Astrocyte-Derived Extracellular Vesicular miR-143-3p Dampens Autophagic Degradation of Endothelial Adhesion Molecules and Promotes Neutrophil Transendothelial Migration after Acute Brain Injury | ||
Sci Adv The support of genetic evidence for cardiovascular risk induced by antineoplastic drugs. | ||
Cell Death Differ Fatty acid synthesis promotes mtDNA release via ETS1-mediated oligomerization of VDAC1 facilitating endothelial dysfunction in sepsis-induced lung injury | ||
Cell Death Dis MicroRNA-181a-5p and microRNA-181a-3p cooperatively restrict vascular inflammation and atherosclerosis. | ||
Cell Death Dis De-ubiquitinase USP35 promotes peritoneal dissemination of gastric cancer by regulating metabolic reprogramming. |
Reviews
What customers say
The single review for this product (rated 3/5) describes a Western Blot on HMEC1 endothelial cells using a 1:1000 dilution. The reviewer noted that the antibody produced many unspecific bands, despite blocking with 5% BSA and an overnight primary antibody incubation. Overall, the feedback suggests the antibody showed limited specificity in this application, with the desired target band distinguishable but accompanied by considerable background.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Yannic (Verified Customer) (01-07-2022) | Left and right band refer to markers. Many unspecific bands, blocked with 5% BSA, primary antibody over night
 |
