SEMG2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SEMG2 Polyclonal antibody (31203-1-AP)

• 

  IHC staining of mouse testis using 31203-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 31203-1-AP (SEMG2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 31203-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 31203-1-AP (SEMG2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SEMG2 Polyclonal Antibody for IHC, ELISA

Cat No. 31203-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

Semenogelin 2, semenogelin II, Semenogelin-2, SGII

---

Tested Applications

• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31203-1-AP targets SEMG2 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35285

  Product name: Recombinant human SEMG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 490-582 aa of NM_003008.2

  Sequence: SQSSISFQIEKLVEGKSQIQTPNPNQDQWSGQNAKGKSGQSADSKQDLLSHEQKGRYKQESSESHNIVITEHEVAQDDHLTQQYNEDRNPIST

• Full Name: semenogelin II
• Calculated Molecular Weight: 65kDa，582aa
• GenBank Accession Number: NM_003008.2
• Gene Symbol: SEMG2
• Gene ID (NCBI): 6407
• RRID: AB_3742408
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q02383
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SEMG2 genes belong to the family of cancer-testis antigens (CTAs), whose expression normally is restricted to male germ cells but is often restored in various malignancies. SEMGs were found expressed in various malignancies including prostate, lung, and renal carcinoma, as well as in some blood neoplasms (PMID: 33311447).