Tested Applications
| Positive WB detected in | HEK-293 cells, COLO 320 cells, human kidney tissue, HepG2 cells, Jurkat cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11462-1-AP targets SKIV2L in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1977 Product name: Recombinant human SKIV2L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 861-1246 aa of BC015758 Sequence: QVSSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGPCDHTVVKLQPGDMAAITTKVLRVNGEKILEDFSKRQQPKFKKDPPLAAVTTAVQELLRLAQAHPAGPPTLDPVNDLQLKDMSVVEGGLRARKLEELIQGAQCVHSPRFPAQYLKLRERMQIQKEMERLRFLLSDQSLLLLPEYHQRVEVLRTLGYVDEVGTVKLAGRVACAMSSHELLLTELMFDNALSTLRPEEIAALLSGLVCQSPGDAGDQLPNTLKQGIERVRAVAKRIGEVQVACGLNQTVEEFVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCIQRLAEMCRSLRGAARLVGEPVLGAKMETAATLLRRDIVFAASLYTQ Predict reactive species |
| Full Name | superkiller viralicidic activity 2-like (S. cerevisiae) |
| Calculated Molecular Weight | 1246 aa, 138 kDa |
| Observed Molecular Weight | 138 kDa |
| GenBank Accession Number | BC015758 |
| Gene Symbol | SKIV2L |
| Gene ID (NCBI) | 6499 |
| RRID | AB_2187472 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15477 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The Ski complex is a multiprotein complex required for exosome-mediated RNA surveillance, including the regulation of normal mRNA and the decay of nonfunctional mRNA. Component of the SKI complex which is thought to be involved in exosome-mediated RNA decay and associates with transcriptionally active genes in a manner dependent on PAF1 complex (PAF1C) [PMID:22444670]. SKIV2L , one component of the Ski complex, acts as an RNA helicase with a role in exosome recruitment or activation. It is involved in the degradation of RNAs by the exosome and may have a role in autophagy [PMID:11719186].
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SKIV2L antibody 11462-1-AP | Download protocol |
| IP protocol for SKIV2L antibody 11462-1-AP | Download protocol |
| WB protocol for SKIV2L antibody 11462-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-SKIV2L antibody (Cat# 11462-1-AP) has 16 citations spanning journals including Nature, Nature Immunology, Science Immunology, PNAS, EMBO Journal, JCI, Nucleic Acids Research, iScience, JBC, and Molecular Cancer Therapeutics. Research fields covered include RNA quality control, antiviral immunity, cancer biology, B-cell development, autoinflammatory disease, telomere biology, and hepatitis B virus pathogenesis.
| Species | Application | Title |
|---|---|---|
Nucleic Acids Res A short splicing isoform of HBS1L links the cytoplasmic exosome and SKI complexes in humans. | ||
Nucleic Acids Res Dom34 mediates targeting of exogenous RNA in the antiviral OAS/RNase L pathway.
| ||
J Clin Invest Cytoplasmic RNA quality control failure engages mTORC1-mediated autoinflammatory disease. |
Reviews
What customers say
Both reviewers used the antibody for Western Blot and reported a band at the expected ~150 kDa size for SKIV2L. However, both noted the presence of non-specific bands at lower molecular weights. One reviewer also observed that the antibody stained two different ladders. Overall, the antibody detects the target protein but shows notable background and non-specific binding, with both users giving it a 3-star rating.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Tsimafei (Verified Customer) (08-04-2024) | Antibody stains a band at ~150 kDa. However other non-specific bands are present
 |
Rachel (Verified Customer) (01-31-2019) | This antibody does produce a band at the expected size for SKIV2L, but it also lights up several lower molecular weight, non-specific bands. Additionally, it stains two different ladders that I have run as well.
|
