SMAD1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SMAD1 Polyclonal antibody (10429-1-AP)

• Featured Product
• KD/KO Validated

SMAD1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10429-1-AP

Publications(41)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

BSP1, BSP-1, hSMAD1, JV41, JV4-1

• 

  WB analysis using 10429-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10429-1-AP (SMAD1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10429-1-AP

  WB result of SMAD1 antibody (10429-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-SMAD1 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 10429-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 10429-1-AP (SMAD1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 10429-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10429-1-AP (SMAD1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse heart using 10429-1-AP

  IP result of anti-SMAD1 (IP:10429-1-AP, 4ug; Detection:10429-1-AP 1:500) with mouse heart tissue lysate 8000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 10429-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 10429-1-AP (SMAD1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 10429-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 10429-1-AP (SMAD1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat liver using 10429-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 10429-1-AP (SMAD1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat liver using 10429-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 10429-1-AP (SMAD1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 10429-1-AP

  Immunofluorescent analysis of HeLa cells using 10429-1-AP (SMAD1 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 10429-1-AP

  Immunofluorescent analysis of HepG2 cells using 10429-1-AP (SMAD1 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HT-1080 cells, HEK-293 cells, HepG2 cells, mouse heart tissue, HeLa cells
• Positive IP detected in: mouse heart tissue
• Positive IHC detected in: human colon tissue, rat liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10429-1-AP targets SMAD1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0701

  Product name: Recombinant human SMAD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 19-229 aa of BC001878

  Sequence: GWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLP

• Full Name: SMAD family member 1
• Calculated Molecular Weight: 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC001878
• Gene Symbol: SMAD1
• Gene ID (NCBI): 4086
• RRID: AB_2247334
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15797
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transforming growth factor-β (TGF-β) superfamily is recognized as one of the largest families of secreted multifunctional peptides exerting different biological effects on a large variety of cell types, such as regulation of hormone secretion, stimulation of extracellular matrix formation, the inhibition of proliferation of many cell types, cell survival, bone formation, and chemotaxis for inflammatory cells. One of the most important proteins that modulate TGF-β ligand activity is the SMAD family proteins. SMAD1 is one of the receptor-activated Smads. It's also a signal transducers of BMP signaling and binds to several proteins involved in ubiquitin-proteasome system (UPS). Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Cancer Cell; Paneth-like transition drives resistance to dual targeting of KRAS and EGFR in colorectal cancer.; Authors - Yuetong Zhang
rat	WB	Bioact Mater; Bioprinted constructs that simulate nerve-bone crosstalk to improve microenvironment for bone repair; Authors - Tianchang Wang
mouse	WB	Carbohydr Polym; In vitro and in silico anti-osteoporosis activities and underlying mechanisms of a fructan, ABW90-1, from Achyranthes bidentate.; Authors - Tianyu Li
mouse,human	WB	Cell Death Dis; The chromatin remodeling protein BRG1 regulates HSC-myofibroblast differentiation and liver fibrosis; Authors - Yuwen Zhu
		Cell Death Dis; Endothelial Robo4 suppresses endothelial-to-mesenchymal transition induced by irradiation and improves hematopoietic reconstitution; Authors - Seyram Yao Adzraku
rat,mouse	WB	Cell Death Dis; BMP-7 ameliorates partial epithelial-mesenchymal transition by restoring SnoN protein level via Smad1/5 pathway in diabetic kidney disease.; Authors - Wei Peng