Tested Applications
| Positive WB detected in | HT-1080 cells, HEK-293 cells, HepG2 cells, mouse heart tissue, HeLa cells |
| Positive IP detected in | mouse heart tissue |
| Positive IHC detected in | human colon tissue, rat liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10429-1-AP targets SMAD1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0701 Product name: Recombinant human SMAD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 19-229 aa of BC001878 Sequence: GWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLP Predict reactive species |
| Full Name | SMAD family member 1 |
| Calculated Molecular Weight | 52 kDa |
| Observed Molecular Weight | 52 kDa |
| GenBank Accession Number | BC001878 |
| Gene Symbol | SMAD1 |
| Gene ID (NCBI) | 4086 |
| RRID | AB_2247334 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15797 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Transforming growth factor-β (TGF-β) superfamily is recognized as one of the largest families of secreted multifunctional peptides exerting different biological effects on a large variety of cell types, such as regulation of hormone secretion, stimulation of extracellular matrix formation, the inhibition of proliferation of many cell types, cell survival, bone formation, and chemotaxis for inflammatory cells. One of the most important proteins that modulate TGF-β ligand activity is the SMAD family proteins. SMAD1 is one of the receptor-activated Smads. It's also a signal transducers of BMP signaling and binds to several proteins involved in ubiquitin-proteasome system (UPS). Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SMAD1 antibody 10429-1-AP | Download protocol |
| IHC protocol for SMAD1 antibody 10429-1-AP | Download protocol |
| IP protocol for SMAD1 antibody 10429-1-AP | Download protocol |
| WB protocol for SMAD1 antibody 10429-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SMAD1 Polyclonal antibody (Cat# 10429-1-AP) has 43 citations published in journals including Cancer Cell, Nature Cancer, PNAS, Cell Death & Disease, International Journal of Biological Sciences, Scientific Reports, Phytomedicine, and Journal of Molecular and Cellular Cardiology. Research fields encompass BMP/Smad signaling, osteoporosis and bone biology, fibrosis, cancer, cardiovascular disease, neuroscience, reproductive biology, and ferroptosis. The antibody is primarily applied in Western blot and immunofluorescence across human, mouse, and rat samples.
| Species | Application | Title |
|---|---|---|
Cancer Cell Paneth-like transition drives resistance to dual targeting of KRAS and EGFR in colorectal cancer. | ||
Bioact Mater Bioprinted constructs that simulate nerve-bone crosstalk to improve microenvironment for bone repair | ||
Carbohydr Polym In vitro and in silico anti-osteoporosis activities and underlying mechanisms of a fructan, ABW90-1, from Achyranthes bidentate. | ||
Cell Death Dis BMP-7 ameliorates partial epithelial-mesenchymal transition by restoring SnoN protein level via Smad1/5 pathway in diabetic kidney disease. | ||
Cell Death Dis Mmu-miR-185 depletion promotes osteogenic differentiation and suppresses bone loss in osteoporosis through the Bgn-mediated BMP/Smad pathway. | ||
Cell Death Dis Endothelial Robo4 suppresses endothelial-to-mesenchymal transition induced by irradiation and improves hematopoietic reconstitution |
