SMAD4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SMAD4 Polyclonal antibody (10231-1-AP)

• Featured Product
• KD/KO Validated

SMAD4 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 10231-1-AP Copied!

Publications (139)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (5)

Applications

WB, IHC, IF, IP, CoIP, ChIP, ELISA

Synonyms

DPC4, hSMAD4, JIP, MAD homolog 4, MADH4

• 

  WB analysis using 10231-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10231-1-AP (SMAD4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10231-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10231-1-AP (SMAD4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10231-1-AP

  WB result of SMAD4 antibody (10231-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SMAD4 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10231-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10231-1-AP (SMAD4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 10231-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 10231-1-AP (SMAD4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 10231-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 10231-1-AP (SMAD4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 10231-1-AP

  IP result of anti-SMAD4 (IP:10231-1-AP, 4ug; Detection:10231-1-AP 1:1500) with HeLa cells lysate 1320 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 10231-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 10231-1-AP (SMAD4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat small intestine using 10231-1-AP

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 10231-1-AP (SMAD4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 10231-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 10231-1-AP (SMAD4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse pancreas using 10231-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 10231-1-AP (SMAD4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse pancreas using 10231-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 10231-1-AP (SMAD4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat small intestine using 10231-1-AP

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 10231-1-AP (SMAD4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 10231-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 10231-1-AP (SMAD4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 10231-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 10231-1-AP (SMAD4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SMAD4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, COLO 320 cells, HCT 116 cells, HEK-293 cells, mouse liver tissue, NIH/3T3 cells, Neuro-2a cells, C6 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human skin cancer tissue, human tonsillitis tissue, human cervical cancer tissue, mouse pancreas tissue, rat small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10231-1-AP targets SMAD4 in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, bovine, hamster, sheep, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0299

  Product name: Recombinant human SMAD4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 13-227 aa of BC002379

  Sequence: NDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPAS

• Full Name: SMAD family member 4
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 63-70 kDa
• GenBank Accession Number: BC002379
• Gene Symbol: SMAD4
• Gene ID (NCBI): 4089
• RRID: AB_2193323
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13485
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mammalian homologs of the Drosophila Mad gene include Smad1, Smad2, Smad3, Smad4 (DPC4), Smad5, Smad6, Smad7 and Smad8. Smad1 and Smad5 are effectors of BMP2 and BMP4 function while Smad2 and Smad3 are involved in TGF and activin-mediated growth modulation. Smad4 has been shown to mediate all of the above activities through interaction with various Smad family members . Smad6 and Smad7 regulate the response to activin/ TGF signaling by interfering with TGF -mediated phosphorylation of other Smad family members. This antibody is a rabbit polyclonal antibody raised against an internal region of human SMAD4.

Publications

What published studies show

The SMAD4 Polyclonal antibody (Cat# 10231-1-AP) has accumulated 139 citations across journals including Nature, Nat Commun, Cancer Res, Mol Cancer, Sci Adv, Cell Death Dis, Front Pharmacol, and Int J Mol Sci. Research fields span TGF-β/SMAD signaling, fibrosis (pulmonary, renal, hepatic, cardiac), oncology (pancreatic, lung, gastric, colorectal, breast, glioma), EMT, osteogenesis, ferroptosis, immune regulation, and reproductive biology.

Automatically generated from the 139 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IP,IF,ChIP	Signal Transduct Target Ther; Annexin A1 binds PDZ and LIM domain 7 to inhibit adipogenesis and prevent obesity; Authors - Lu Fang
mouse	WB	Nature; Post-translational control of beige fat biogenesis by PRDM16 stabilization; Authors - Qiang Wang
human	WB,IF	Mol Cancer; HDAC6 orchestrates metastatic and immunosuppressive programs in small cell lung cancer through S100A2-TGF-β/SMAD and CSF1R signaling.; Authors - Yantao Jiang
mouse	WB	Cancer Res; MPND Loss Epigenetically Activates TGF-β/SMAD3 Signaling to Drive Tumor Progression and Metastasis in Non-small Cell Lung Cancer.; Authors - Jianfeng Yu
		Nat Commun; A Rras2-BMPR2 feedback loop sustains osteogenesis and represents a therapeutic target for osteoporosis.; Authors - Renlei Yang
mouse,human	WB,IHC,ChIP	Nat Commun; Phosphorylation of FOXN3 by NEK6 promotes pulmonary fibrosis through Smad signaling; Authors - Jinjin Yu