SMAD7 Monoclonal antibody

• 

  WB analysis using 66478-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66478-1-Ig (SMAD7 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse cerebellum using 66478-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 66478-1-Ig (SMAD7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 66478-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 66478-1-Ig (SMAD7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 66478-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66478-1-Ig (SMAD7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 66478-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66478-1-Ig (SMAD7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SMAD7 Monoclonal Antibody for WB, IF, IHC, ELISA

Cat No. 66478-1-Ig

Clone No.2B9A4

Publications(11)

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat, pig and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CRCS3, hSMAD7, MAD homolog 7, MAD homolog 8, MADH7, MADH8, Mothers against DPP homolog 7, Mothers against DPP homolog 8, SMAD 7, SMAD family member 7, SMAD7

---

Tested Applications

• Positive WB detected in: pig brain tissue, pig kidney tissue, rat brain tissue, rat kidney tissue, mouse brain tissue, mouse skeletal muscle tissue
• Positive IHC detected in: mouse cerebellum tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 11 publications below

Product Information

66478-1-Ig targets SMAD7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples.

• Tested Reactivity: Human, mouse, rat, pig
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13688

  Product name: Recombinant human SMAD7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-426 aa of BC074819

  Sequence: MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEVIFNSR

• Full Name: SMAD family member 7
• Calculated Molecular Weight: 426 aa, 46 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC074819
• Gene Symbol: SMAD7
• Gene ID (NCBI): 4092
• RRID: AB_2881844
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15105
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMAD7, also named as Mothers against decapentaplegic homolog 7, is a 426 amino acid protein, which belongs to the dwarfin/SMAD family. SMAD7 Interaction with NEDD4L or RNF111 induces translocation from the nucleus to the cytoplasm (PubMed:16601693). TGF-beta stimulates its translocation from the nucleus to the cytoplasm. PDPK1 inhibits its translocation from the nucleus to the cytoplasm in response to TGF-beta (PubMed:17327236). SMAD7 as antagonist of signaling by TGF-beta (transforming growth factor) type 1 receptor superfamily members has been shown to inhibit TGF-beta (Transforming growth factor) and activin signaling by associating with their receptors thus preventing SMAD2 access. SMAD7 functions as an adapter to recruit SMURF2 to the TGF-beta receptor complex and also acts by recruiting the PPP1R15A-PP1 complex to TGFBR1, which promotes its dephosphorylation. SMAD7 positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Acta Pharmacol Sin; The multifunctional adaptor protein HIP-55 couples Smad7 to accelerate TGF-β type I receptor degradation.; Authors - Yang Sun ; KD Validated
human	WB	Aging (Albany NY); LINC00968 can inhibit the progression of lung adenocarcinoma through the miR-21-5p/SMAD7 signal axis.; Authors - Yuxing Zhu
rat	WB	Biomed Pharmacother; Yu Gan Long reduces rat liver fibrosis by blocking TGF-β1/Smad pathway and modulating the immunity.; Authors - Yu Xia
mouse	WB	J Ethnopharmacol; Wu-Mei-Wan ameliorates chronic colitis-associated intestinal fibrosis through inhibiting fibroblast activation.; Authors - Fan Wu
human	WB	Exp Cell Res; Exosomes derived from thymic stromal lymphopoietin-treated dendritic cells regulate T helper 17/regulatory T cell differentiation via miR-21/Smad7 axis.; Authors - Qingshan Ji
rat	WB	Biochem Biophys Res Commun; Emodin ameliorates tubulointerstitial fibrosis in obstructed kidneys by inhibiting EZH2.; Authors - Lin Xu