Use Able AI chat for product recommendations

SMAD7 Monoclonal antibody

SMAD7 Monoclonal Antibody for WB, IF, IHC, ELISA

Cat No. 66478-1-Ig
Clone No.2B9A4

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat, pig and More (1)

Applications

WB, IHC, IF/ICC, ELISA

CRCS3, hSMAD7, MAD homolog 7, MAD homolog 8, MADH7, MADH8, Mothers against DPP homolog 7, Mothers against DPP homolog 8, SMAD 7, SMAD family member 7, SMAD7

Formulation:  PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig brain tissue, pig kidney tissue, rat brain tissue, rat kidney tissue, mouse brain tissue, mouse skeletal muscle tissue
Positive IHC detected inmouse cerebellum tissue, human kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66478-1-Ig targets SMAD7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples.

Tested Reactivity Human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13688

Product name: Recombinant human SMAD7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-426 aa of BC074819

Sequence: MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEVIFNSR

Predict reactive species
Full Name SMAD family member 7
Calculated Molecular Weight 426 aa, 46 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC074819
Gene Symbol SMAD7
Gene ID (NCBI) 4092
RRIDAB_2881844
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15105
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMAD7, also named as Mothers against decapentaplegic homolog 7, is a 426 amino acid protein, which belongs to the dwarfin/SMAD family. SMAD7 Interaction with NEDD4L or RNF111 induces translocation from the nucleus to the cytoplasm (PubMed:16601693). TGF-beta stimulates its translocation from the nucleus to the cytoplasm. PDPK1 inhibits its translocation from the nucleus to the cytoplasm in response to TGF-beta (PubMed:17327236). SMAD7 as antagonist of signaling by TGF-beta (transforming growth factor) type 1 receptor superfamily members has been shown to inhibit TGF-beta (Transforming growth factor) and activin signaling by associating with their receptors thus preventing SMAD2 access. SMAD7 functions as an adapter to recruit SMURF2 to the TGF-beta receptor complex and also acts by recruiting the PPP1R15A-PP1 complex to TGFBR1, which promotes its dephosphorylation. SMAD7 positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.

Publications

SpeciesApplicationTitle
human,mouseWB

Acta Pharmacol Sin

The multifunctional adaptor protein HIP-55 couples Smad7 to accelerate TGF-β type I receptor degradation.

Authors - Yang Sun
  • KD Validated
humanWB

Aging (Albany NY)

LINC00968 can inhibit the progression of lung adenocarcinoma through the miR-21-5p/SMAD7 signal axis.

Authors - Yuxing Zhu
ratWB

Biomed Pharmacother

Yu Gan Long reduces rat liver fibrosis by blocking TGF-β1/Smad pathway and modulating the immunity.

Authors - Yu Xia
mouseWB

J Ethnopharmacol

Wu-Mei-Wan ameliorates chronic colitis-associated intestinal fibrosis through inhibiting fibroblast activation.

Authors - Fan Wu
humanWB

Exp Cell Res

Exosomes derived from thymic stromal lymphopoietin-treated dendritic cells regulate T helper 17/regulatory T cell differentiation via miR-21/Smad7 axis.

Authors - Qingshan Ji
ratWB

Biochem Biophys Res Commun

Emodin ameliorates tubulointerstitial fibrosis in obstructed kidneys by inhibiting EZH2.

Authors - Lin Xu
Loading...
||
New chat

Able

正在加载,请稍候...