Tested Applications
| Positive WB detected in | mouse testis tissue, mouse brain tissue, rat heart tissue, mouse spleen tissue |
| Positive IHC detected in | human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12129-1-AP targets SNAI2/SLUG in WB, IHC, IF, FC (Intra), CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2773 Product name: Recombinant human SNAI2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-268 aa of BC015895 Sequence: MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH Predict reactive species |
| Full Name | snail homolog 2 (Drosophila) |
| Calculated Molecular Weight | 268 aa, 30 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC015895 |
| Gene Symbol | SLUG |
| Gene ID (NCBI) | 6591 |
| RRID | AB_2191889 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43623 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SNAI2 belongs to the Snail family of zinc finger transcription factors, which shares an evolutionarily conserved role in mesoderm formation in vertebrates and invertebrates. It tiggers epithelial-mesenchymal transitions and has a crucial role in developmental processes. Also it is a transcriptional reperssor in mediating RAF-induced expression of TJ protein, occludin(OCLN) and subsequent oncogenic transformation of epithelial cells.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SNAI2/SLUG antibody 12129-1-AP | Download protocol |
| IHC protocol for SNAI2/SLUG antibody 12129-1-AP | Download protocol |
| WB protocol for SNAI2/SLUG antibody 12129-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SNAI2/SLUG Polyclonal antibody (catalog no. 12129-1-AP) has 269 citations. These appear across journals including Molecular Cancer, Gastroenterology, Nature Communications, Theranostics, Journal of Experimental & Clinical Cancer Research, Cell Death & Disease, Cancer Letters, Oncogene, Journal of Translational Medicine, and International Journal of Biological Sciences. Research fields are dominated by cancer biology, particularly epithelial-mesenchymal transition (EMT), tumor metastasis, and signaling pathways (Wnt/β-catenin, PI3K/AKT, TGF-β), spanning ovarian, breast, gastric, lung, liver, and other cancers.
| Species | Application | Title |
|---|---|---|
Mol Cancer Systematic analyses reveal long non-coding RNA (PTAF)-mediated promotion of EMT and invasion-metastasis in serous ovarian cancer. | ||
Mol Cancer The long non-coding RNA PTTG3P promotes cell growth and metastasis via up-regulating PTTG1 and activating PI3K/AKT signaling in hepatocellular carcinoma. | ||
Gastroenterology Cancer-associated endocrine cells participate in pancreatic carcinogenesis | ||
Drug Resist Updat Endothelial SMAD1-MCAM axis facilitates sunitinib resistance and progression of clear cell renal cell carcinoma via LAMB1-ITGB1 signaling. | ||
Nat Commun Intercellular chemerin-cmklr1 couples epicardial mechanosensing to fibroblasts in pressure overload. | ||
Clin Oral Implants Res Characterization of macrophages infiltrating peri-implantitis lesions. |
Reviews
What customers say
The single review for this product reports a 5-star rating. The user tested it in Western Blot at a 1:500 dilution on glioblastoma cells and noted that it "worked well." Overall, the feedback is positive, with the antibody performing as expected in the stated application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Udesh (Verified Customer) (08-16-2023) | Worked well in WB at 1:500
|
