Use Able AI chat for product recommendations

SP3 Polyclonal antibody

SP3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26584-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ChIP, ELISA

SPR 2, SPR-2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPC-3 cells, C2C12 cell, COLO 320 cells
Positive IHC detected inmouse lung tissue, human ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26584-1-AP targets SP3 in WB, IHC, ChIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25082

Product name: Recombinant human SP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 412-590 aa of BC126414

Sequence: IVQGITPQTIHGVQASGQNISQQALQNLQLQLNPGTFLIQAQTVTPSGQVTWQTFQVQGVQNLQNLQIQNTAAQQITLTPVQTLTLGQVAAGGAFTSTPVSLSTGQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQ

Predict reactive species
Full Name Sp3 transcription factor
Calculated Molecular Weight 781 aa, 82 kDa
Observed Molecular Weight 70 kDa, 115 kDa
GenBank Accession NumberBC126414
Gene Symbol SP3
Gene ID (NCBI) 6670
RRIDAB_2880563
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ02447
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SP3, also named as transcription factor Sp3, is a 781 amino acid protein, which contains 3 C2H2-type zinc fingers and belongs to the Sp1 C2H2-type zinc-finger protein family. SP3 localizes to the nuclear periphery and in nuclear dots when sumoylated. Some localization in PML nuclear bodies. SP3 is acetylated by histone acetyltransferase p300, deacetylated by HDACs and sumoylated on all isoforms. Sumoylated on 2 sites in longer isoforms with Lys-551 being the major site. Sumoylation at this site promotes nuclear localization to the nuclear periphery, nuclear dots and PML nuclear bodies. Sumoylation on Lys-551 represses the transactivation activity, except for the largest isoform, L-Sp3, which has little effect on transactivation. Alternate sumoylation and acetylation at Lys-551 also control transcriptional activity. There exist tow modified isoform and molecular weight of those are 70 kda and 115 kda.

Protocols

Product Specific Protocols
IHC protocol for SP3 antibody 26584-1-APDownload protocol
WB protocol for SP3 antibody 26584-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Dig Dis Sci

Speckle-Type POZ Protein Down-Regulates Matrix Metalloproteinase 2 Expression via Sp1/PI3K/Akt Signaling Pathway in Colorectal Cancer.

Authors - Shouhua Zhang

Int Immunopharmacol

Deficiency of LAMP2A in macrophages accelerates hypoxia-induced atherosclerosis by inhibiting BNIP3-mediated mitophagy.

Authors - Ning Wang
humanChIP

bioRxiv

The Elevated Expression of ORF75, a Lytic KSHV Gene, in Kaposi Sarcoma Lesions is Driven by a GC-rich DNA cis Element in its Promoter Region.

Authors - Ashwin Nair
mouseWB

Cell Rep

LHPP-mediated inorganic pyrophosphate hydrolysis-driven lysosomal acidification in astrocytes regulates adult neurogenesis

Authors - Longze Sha
humanWB

Biochem Biophys Res Commun

Transcriptional activation of CSTB gene expression by transcription factor Sp3

Authors - Weiyi Zhu
humanChIP

PLoS Pathog

The elevated expression of ORF75, a KSHV lytic gene, in Kaposi sarcoma lesions is driven by a GC-rich DNA cis element in its promoter region

Authors - Ashwin Nair

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Anh (Verified Customer) (07-15-2021)

clear bands, have some unspecific bands

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: mouse heart
SP3 Antibody Western Blot validation (1:500 dilution) in mouse heart (Cat no:26584-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...