Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SPARC Monoclonal antibody

SPARC Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66426-1-Ig
Clone No.1A2C1

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

1A2C1, Basement membrane protein 40, Basement-membrane protein 40, BM 40, BM-40

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells, human testis tissue, NCCIT cells
Positive IHC detected inhuman placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inC6 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66426-1-Ig targets SPARC in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7390

Product name: Recombinant human SPARC protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-303 aa of BC004974

Sequence: MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

Predict reactive species
Full Name secreted protein, acidic, cysteine-rich (osteonectin)
Calculated Molecular Weight 35 kDa
Observed Molecular Weight 38 kDa, 52 kDa
GenBank Accession NumberBC004974
Gene Symbol SPARC
Gene ID (NCBI) 6678
RRIDAB_2881797
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP09486
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPARC, also known as ON (Osteonectin) or BM-40 (Basement-membrane protein 40), is an extracellular glycoprotein with the calculated molecular mass of 35 kDa and the apparent molecular mass of 40-43 kDa and 50 kDa (PMID: 7495300, 12365801). SPARC belongs to a group of matricellular proteins defined as secreted components that do not contribute directly to the formation of structural elements but serve to modulate cell-matrix interactions and cellular functions (PMID: 7542656; 12231357). SPARC is expressed at high levels in bone tissue, is distributed widely in many other tissues and cell types, and is associated generally with tissues undergoing morphogenesis, remodeling and wound repair (PMID: 10567433). It elicits changes in cell shape, inhibits cell-cycle progression, and influences the synthesis of extracellular matrix (PMID: 12721366). Altered expression of SPARC has been reported in a variety of cancers, which include breast, ovarian, colorectal, and pancreatic cancer as well as melanoma and glioblastomas (PMID: 18849185).

Protocols

Product Specific Protocols
IF protocol for SPARC antibody 66426-1-IgDownload protocol
IHC protocol for SPARC antibody 66426-1-IgDownload protocol
WB protocol for SPARC antibody 66426-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanIHC

Adv Sci (Weinh)

Elevated SPARC Disrupts the Intestinal Barrier Integrity in Crohn's Disease by Interacting with OTUD4 and Activating the MYD88/NF-κB Pathway

Authors - Jiayu Wang
mouse,humanWB

Int J Cancer

Tissue-resident CXCR4+ macrophage as a poor prognosis signature promotes pancreatic ductal adenocarcinoma progression

Authors - Zhenyu Liao
humanWB

Br J Cancer

Inactivation of 3-hydroxybutyrate dehydrogenase type 2 promotes proliferation and metastasis of nasopharyngeal carcinoma by iron retention.

Authors - Bo Li
humanWB

Front Endocrinol (Lausanne)

Secreted Protein Acidic and Rich in Cysteine Mediates the Development and Progression of Diabetic Retinopathy.

Authors - Liying Luo
mouseWB

Exp Cell Res

Sorafenib derivatives-functionalized gold nanoparticles confer protection against tumor angiogenesis and proliferation via suppression of EGFR and VEGFR-2.

Authors - Wei Huang
humanWB

Pathol Res Pract

Downregulation of NEBL promotes migration and invasion of clear cell renal cell carcinoma by inducing epithelial-mesenchymal transition

Authors - Ran Zhao
Loading...
||
New chat

Able

正在加载,请稍候...