Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SPHK2 Polyclonal antibody

SPHK2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 17096-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

EC:2.7.1.91, SK 2, SK-2, Sphingosine kinase 2, SPK 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inL02 cells, mouse brain tissue, human kidney tissue, A549 cells, mouse heart tissue, rat brain tissue, Raji cells, HCT 116 cells, mouse kidney tissue, mouse liver tissue
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman breast cancer tissue, human kidney tissue, human liver tissue, mouse kidney tissue, rat kidney tissue, rat small intestine tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17096-1-AP targets SPHK2 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10569

Product name: Recombinant human SPHK2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 266-618 aa of BC010671

Sequence: LNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTLGTVLGLATLHTYRGRLSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSVSDLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKAALHSPVSEGAPVIPPSSGLPLPTPDARVGASTCGPPDHLLPPLGTPLPPDWVTLEGDFVLMLAISPSHLGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMERGSHFSLGCPQLGYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGIGTLLTGPPGCPGREP

Predict reactive species
Full Name sphingosine kinase 2
Calculated Molecular Weight 618 aa, 65 kDa
Observed Molecular Weight 65-70 kDa
GenBank Accession NumberBC010671
Gene Symbol SPHK2
Gene ID (NCBI) 56848
RRIDAB_10598479
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NRA0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPHK2(Sphingosine kinase 2) is also named as SK2, SPK2 and catalyzes the phosphorylation of sphingosine to form sphingosine 1-phosphate (SPP), a lipid mediator with both intra- and extracellular functions. SPHK2 associates with HDAC1 and HDAC2 in repressor complexes and is selectively enriched at the promoters of the genes encoding the cyclin-dependent kinase inhibitor p21 or the transcriptional regulator c-fos, where it enhanced local histone H3 acetylation and transcription.SphK2 is a ~66kDa protein that is most abundantly expressed in the liver and heart(PMID:19168577). SphK2 has two splice variants, which are the 68-kDa SphK2-S and the NH2-terminal extended 72-kDa SphK2-L (PMID:17974990).

Protocols

Product Specific Protocols
FC protocol for SPHK2 antibody 17096-1-APDownload protocol
IF protocol for SPHK2 antibody 17096-1-APDownload protocol
IHC protocol for SPHK2 antibody 17096-1-APDownload protocol
IP protocol for SPHK2 antibody 17096-1-APDownload protocol
WB protocol for SPHK2 antibody 17096-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
rat,mouseWB,IF

Cell Metab

Sphingolipid metabolism controls mammalian heart regeneration

Authors - Xiaoqian Ji
  • KD Validated
humanWB

Circ Res

Altered Smooth Muscle Cell Histone Acetylome by the SPHK2/S1P Axis Promotes Pulmonary Hypertension

Authors - A Dushani C U Ranasinghe
humanWB

Blood

Targeting sphingosine kinase 1 induces MCL1 dependent cell death in acute myeloid leukemia.

Authors - Jason A Powell
rat,humanWB,IHC,IF

Bioact Mater

Injectable cartilage matrix hydrogel loaded with cartilage endplate stem cells engineered to release exosomes for non-invasive treatment of intervertebral disc degeneration.

Authors - Liwen Luo
humanWB,IP,IF

Oncogene

Cytoplasmic dynein regulates the subcellular localization of sphingosine kinase 2 to elicit tumor-suppressive functions in glioblastoma.

Authors - Heidi A Neubauer
humanWB

PLoS Pathog

Sphingosine kinase 1/S1P receptor signaling axis is essential for cellular uptake of Neisseria meningitidis in brain endothelial cells

Authors - Ingo Fohmann

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Yasuyo (Verified Customer) (02-23-2023)

Clear staining in mouse kidney paraffin section

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1 to 200
  • Cell Tissue Type: kidney
SPHK2 Antibody Immunohistochemistry validation (1 to 200 dilution) in kidney (Cat no:17096-1-AP)
FH

Hua (Verified Customer) (01-23-2023)

Good antibody. Works well on WB.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:4000
  • Cell Tissue Type: mouse liver and mouse brain
SPHK2 Antibody Western Blot validation (1:4000 dilution) in mouse liver and mouse brain (Cat no:17096-1-AP)
FH

Jason (Verified Customer) (06-09-2021)

Clear staining in mouse liver paraffin section.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: liver
SPHK2 Antibody Immunohistochemistry validation (1:100 dilution) in liver (Cat no:17096-1-AP)
FH

David (Verified Customer) (05-04-2021)

It works for cell IF in vitro.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: A549 cell line
SPHK2 Antibody Immunofluorescence validation (1:100 dilution) in A549 cell line (Cat no:17096-1-AP)
FH

Chen (Verified Customer) (03-13-2021)

Works good for cell immunofluorescence assay in vitro.

  • Applications: Immunofluorescence
  • Cell Tissue Type: Heart cells
SPHK2 Antibody Immunofluorescence validation ( dilution) in Heart cells (Cat no:17096-1-AP)
FH

Wei (Verified Customer) (03-12-2020)

Sharp and clear band from mouse heart lysates

  • Applications: Western Blot,
  • Cell Tissue Type: Mouse Heart
Loading...
||
New chat

Able

正在加载,请稍候...