Tested Applications
| Positive WB detected in | L02 cells, A549 cells, human kidney tissue, mouse brain tissue, Raji cells, mouse heart tissue, HCT 116 cells, rat brain tissue, mouse kidney tissue, mouse liver tissue, Ramos cells |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human breast cancer tissue, human kidney tissue, human liver tissue, mouse kidney tissue, rat kidney tissue, rat small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 ul suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17096-1-AP targets SPHK2 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10569 Product name: Recombinant human SPHK2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 267-618 aa of BC010671 Sequence: NCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTLGTVLGLATLHTYRGRLSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSVSDLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKAALHSPVSEGAPVIPPSSGLPLPTPDARVGASTCGPPDHLLPPLGTPLPPDWVTLEGDFVLMLAISPSHLGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMERGSHFSLGCPQLGYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGIGTLLTGPPGCPGREP Predict reactive species |
| Full Name | sphingosine kinase 2 |
| Calculated Molecular Weight | 618 aa, 65 kDa |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC010671 |
| Gene Symbol | SPHK2 |
| Gene ID (NCBI) | 56848 |
| RRID | AB_10598479 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NRA0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SPHK2(Sphingosine kinase 2) is also named as SK2, SPK2 and catalyzes the phosphorylation of sphingosine to form sphingosine 1-phosphate (SPP), a lipid mediator with both intra- and extracellular functions. SPHK2 associates with HDAC1 and HDAC2 in repressor complexes and is selectively enriched at the promoters of the genes encoding the cyclin-dependent kinase inhibitor p21 or the transcriptional regulator c-fos, where it enhanced local histone H3 acetylation and transcription.SphK2 is a ~66kDa protein that is most abundantly expressed in the liver and heart(PMID:19168577). SphK2 has two splice variants, which are the 68-kDa SphK2-S and the NH2-terminal extended 72-kDa SphK2-L (PMID:17974990).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SPHK2 antibody 17096-1-AP | Download protocol |
| IF protocol for SPHK2 antibody 17096-1-AP | Download protocol |
| IHC protocol for SPHK2 antibody 17096-1-AP | Download protocol |
| IP protocol for SPHK2 antibody 17096-1-AP | Download protocol |
| WB protocol for SPHK2 antibody 17096-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SPHK2 Polyclonal antibody (Cat# 17096-1-AP) has 69 citations. These appear in journals including Cell Metabolism, Blood, Circulation Research, Oncogene, Cell Reports, British Journal of Pharmacology, Journal of Ethnopharmacology, Biochemical Pharmacology, Oncogenesis, International Journal of Molecular Sciences, PLoS Pathogens, Journal of Lipid Research, Journal of Biological Chemistry, FASEB Journal, and eLife. Research fields span sphingolipid metabolism, liver disease, cancer, cardiovascular disorders, fibrosis, and neurology.
| Species | Application | Title |
|---|---|---|
Cell Metab Adipokine IL-11/IL-11Ra constrains sphingolipid metabolism to limit the thermogenic capacity of beige adipocytes. | ||
Blood Targeting sphingosine kinase 1 induces MCL1 dependent cell death in acute myeloid leukemia. | ||
Bioact Mater Injectable cartilage matrix hydrogel loaded with cartilage endplate stem cells engineered to release exosomes for non-invasive treatment of intervertebral disc degeneration. | ||
Circ Res Altered Smooth Muscle Cell Histone Acetylome by the SPHK2/S1P Axis Promotes Pulmonary Hypertension | ||
Sci China Life Sci SPHK1 deficiency promotes intestinal homeostasis by ameliorating ER stress-induced gastrointestinal injury during murine graft-versus-host disease. |
Reviews
What customers say
Able is busy answering your previous question. Please try again later.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Yasuyo (Verified Customer) (02-23-2023) | Clear staining in mouse kidney paraffin section
 |
Hua (Verified Customer) (01-23-2023) | Good antibody. Works well on WB.
 |
Jason (Verified Customer) (06-09-2021) | Clear staining in mouse liver paraffin section.
 |
David (Verified Customer) (05-04-2021) | It works for cell IF in vitro.
 |
Chen (Verified Customer) (03-13-2021) | Works good for cell immunofluorescence assay in vitro.
 |
Wei (Verified Customer) (03-12-2020) | Sharp and clear band from mouse heart lysates
|
